@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XXS5: (2018-01-05 )
MSVHIEAKEGEIADKILLPGDPLRAKYIAETFLEDPVCYNQVRGMLGFTGKYKGERISVQGTGMGMPSATIYAHELIQSYGVKKLIRVGTCGALSKDVHVRDLVLAQGAATSSSMIEKNFQAFHFPPISDFNLLLKAYEIAKEKGYTVHVGNVLSEDSFYKDDLTETFQLAELGVLGVEMEAAALYYLGAKYHVQTLSLMTVSDHLITGEETTAAERQSTFNEMIEVGLETAIAE

Atome Classification :

(76 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADN_M_13(2AC7)
DEOD_BACAN
[Raw transfer]




2FA_B_4(4DAN)
DEOD_BACSU
[Raw transfer]




ADN_Q_17(1PK7)
DEOD_ECO57
[Raw transfer]




2FA_A_3(4DAN)
DEOD_BACSU
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




FMC_B_6(3UT6)
DEOD_ECOLI
[Raw transfer]




FMC_A_4(3UT6)
DEOD_ECOLI
[Raw transfer]




FMC_C_9(3UT6)
DEOD_ECOLI
[Raw transfer]




2FA_M_13(1PK9)
DEOD_ECO57
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




ADN_A_2(3UAY)
DEOD_BACCE
[Raw transfer]




NOS_Q_17(1PR0)
DEOD_ECO57
[Raw transfer]




NOS_A_2(3UAZ)
DEOD_BACCE
[Raw transfer]




XYA_M_13(1PR6)
DEOD_ECO57
[Raw transfer]




2FA_Q_17(1PK9)
DEOD_ECO57
[Raw transfer]




2FA_O_15(1PK9)
DEOD_ECO57
[Raw transfer]




FMB_Q_17(1PR1)
DEOD_ECO57
[Raw transfer]




TBN_Q_17(1PR5)
DEOD_ECO57
[Raw transfer]




NOS_M_13(1PR0)
DEOD_ECO57
[Raw transfer]




FMB_O_15(1PR1)
DEOD_ECO57
[Raw transfer]




TBN_M_13(1PR5)
DEOD_ECO57
[Raw transfer]




NOS_O_15(1PR0)
DEOD_ECO57
[Raw transfer]




ADN_M_13(1PK7)
DEOD_ECO57
[Raw transfer]




TBN_O_15(1PR5)
DEOD_ECO57
[Raw transfer]




XYA_Q_17(1PR6)
DEOD_ECO57
[Raw transfer]




MTP_Q_17(1PR4)
DEOD_ECO57
[Raw transfer]




FMB_M_13(1PR1)
DEOD_ECO57
[Raw transfer]




ADN_A_3(4D9H)
DEOD_BACSU
[Raw transfer]




FMB_C_9(1A69)
DEOD_ECOLI
[Raw transfer]




XYA_O_15(1PR6)
DEOD_ECO57
[Raw transfer]




TBN_A_2(4DAR)
DEOD_BACSU
[Raw transfer]




FMB_B_7(1A69)
DEOD_ECOLI
[Raw transfer]




6CR_A_2(4DAE)
DEOD_BACSU
[Raw transfer]




ADN_O_15(1PK7)
DEOD_ECO57
[Raw transfer]




GOL_A_9(4DAB)
DEOD_BACSU
[Raw transfer]




MTP_O_15(1PR4)
DEOD_ECO57
[Raw transfer]




MTP_M_13(1PR4)
DEOD_ECO57
[Raw transfer]




RAB_O_15(1PW7)
DEOD_ECO57
[Raw transfer]




RAB_Q_17(1PW7)
DEOD_ECO57
[Raw transfer]




2FD_G_7(1Z34)
?
[Raw transfer]




2FD_Q_17(1PKE)
DEOD_ECO57
[Raw transfer]




2FD_M_13(1PKE)
DEOD_ECO57
[Raw transfer]




RAB_M_13(1PW7)
DEOD_ECO57
[Raw transfer]




2FD_O_15(1PKE)
DEOD_ECO57
[Raw transfer]




MDR_O_15(1PR2)
DEOD_ECO57
[Raw transfer]




GNG_A_2(4DA0)
DEOD_BACSU
[Raw transfer]




GA2_A_2(4DA6)
DEOD_BACSU
[Raw transfer]




AC2_A_2(4DA7)
DEOD_BACSU
[Raw transfer]




MDR_Q_17(1PR2)
DEOD_ECO57
[Raw transfer]




BG2_A_2(4DA8)
DEOD_BACSU
[Raw transfer]




MDR_M_13(1PR2)
DEOD_ECO57
[Raw transfer]




AC2_B_6(5I3C)
DEOD_ECOLI
[Raw transfer]




AC2_C_8(5I3C)
DEOD_ECOLI
[Raw transfer]




ADE_B_4(4DAO)
DEOD_BACSU
[Raw transfer]




ADE_B_8(4D8V)
DEOD_BACSU
[Raw transfer]




ADE_A_3(4DAO)
DEOD_BACSU
[Raw transfer]




7HX_A_4(5IU6)
DEOD_ECOLI
[Raw transfer]




AC2_A_4(5I3C)
DEOD_ECOLI
[Raw transfer]




HPA_A_2(4DAB)
DEOD_BACSU
[Raw transfer]




7HX_C_8(5IU6)
DEOD_ECOLI
[Raw transfer]




6MP_O_15(1OTY)
DEOD_ECOLI
[Raw transfer]




6MP_Q_17(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_O_15(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_M_13(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_M_13(1OTY)
DEOD_ECOLI
[Raw transfer]




ADE_A_5(4D8V)
DEOD_BACSU
[Raw transfer]




7HX_B_6(5IU6)
DEOD_ECOLI
[Raw transfer]




6MP_Q_17(1OTY)
DEOD_ECOLI
[Raw transfer]




2 PsiBlast_PDB 95.4665%-109 - C2 -3UAW 5.1 DEOD_BACCE
4 PsiBlast_PDB 94.8264%-113 - C2 -3UAZ 4.9 DEOD_BACCE
3 PsiBlast_PDB 94.3264%-115 - C2 -3UAY 4.7 DEOD_BACCE
32 PsiBlast_CBE 93.2560%-106 - C2 -4D8Y - DEOD_BACSU -
1 PsiBlast_PDB 93.0965%-123 - C2 -2AC7 - DEOD_BACAN -
142 HHSearch 92.9864% -98 - C2 -4TYM - ? -
36 PsiBlast_CBE 92.7060%-105 - C2 -4D8V 3.3 DEOD_BACSU
31 PsiBlast_CBE 92.3560%-103 - C2 -4D8Y - DEOD_BACSU -
33 PsiBlast_CBE 92.2260%-104 - C2 -4D8Y - DEOD_BACSU -
35 PsiBlast_CBE 92.2060%-106 - C2 -4D8Y - DEOD_BACSU -
15 PsiBlast_PDB 92.0860%-103 - C2 -4DAB 4.0 DEOD_BACSU
20 PsiBlast_PDB 92.0359%-119 - C2 -4M3N - ? -
5 PsiBlast_PDB 91.9664%-112 - C2 -1XE3 - DEOD_BACAN -
13 PsiBlast_PDB 91.8060%-103 - C2 -4DA7 4.3 DEOD_BACSU
34 PsiBlast_CBE 91.6960%-105 - C2 -4D8Y - DEOD_BACSU -
21 PsiBlast_CBE 91.5465%-121 - C2 -2AC7 5.1 DEOD_BACAN
10 PsiBlast_PDB 91.4960%-107 - C2 -4D9H 4.9 DEOD_BACSU
17 PsiBlast_PDB 91.4360%-106 - C2 -4DAN 5.2 DEOD_BACSU
16 PsiBlast_PDB 91.3860%-106 - C2 -4DAE 5.5 DEOD_BACSU
14 PsiBlast_PDB 91.3860%-106 - C2 -4DA8 5.0 DEOD_BACSU
12 PsiBlast_PDB 91.2960%-105 - C2 -4DA6 4.9 DEOD_BACSU
19 PsiBlast_PDB 90.4160%-111 - C2 -4DAR 4.5 DEOD_BACSU
6 PsiBlast_PDB 90.3460%-101 - C2 -4D8V 3.1 DEOD_BACSU
11 PsiBlast_PDB 90.0460%-105 - C2 -4DA0 4.9 DEOD_BACSU
28 PsiBlast_CBE 89.4260%-107 - C2 -4DAN 5.1 DEOD_BACSU
139 HHSearch 89.1164% -91 - C2 -3UAW 5.1 DEOD_BACCE
18 PsiBlast_PDB 88.5960%-109 - C2 -4DAO 3.2 DEOD_BACSU
27 PsiBlast_CBE 88.4460%-102 - C2 -4DAO 3.3 DEOD_BACSU
120 PsiBlast_CBE 88.4253%-104 - C2 -1PK9 5.3 DEOD_ECO57
57 PsiBlast_CBE 88.3453%-104 - C2 -1PR4 5.1 DEOD_ECO57
60 PsiBlast_CBE 88.1353%-104 - C2 -1PR2 5.1 DEOD_ECO57
86 PsiBlast_CBE 87.8953%-100 - C2 -3UT6 4.4 DEOD_ECOLI
135 PsiBlast_CBE 87.7453%-105 - C2 -1OTY 3.2 DEOD_ECOLI
63 PsiBlast_CBE 87.6053%-108 - C2 -1PR1 4.5 DEOD_ECO57
47 PsiBlast_CBE 87.0553%-104 - C2 -1PW7 4.1 DEOD_ECO57
121 PsiBlast_CBE 86.6653%-105 - C2 -1PK9 5.4 DEOD_ECO57
87 PsiBlast_CBE 86.4053%-100 - C2 -3UT6 4.3 DEOD_ECOLI
118 PsiBlast_CBE 86.3853%-102 - C2 -1PKE 5.0 DEOD_ECO57
51 PsiBlast_CBE 86.2853%-102 - C2 -1PR6 4.7 DEOD_ECO57
131 PsiBlast_CBE 86.1853%-106 - C2 -1OU4 3.3 DEOD_ECOLI
69 PsiBlast_CBE 86.0653%-104 - C2 -5IU6 3.4 DEOD_ECOLI
132 PsiBlast_CBE 86.0253%-105 - C2 -1OU4 3.0 DEOD_ECOLI
117 PsiBlast_CBE 85.9953%-105 - C2 -1PKE 4.6 DEOD_ECO57
49 PsiBlast_CBE 85.9353%-102 - C2 -1PW7 4.3 DEOD_ECO57
122 PsiBlast_CBE 85.8753%-105 - C2 -1PK7 5.1 DEOD_ECO57
123 PsiBlast_CBE 85.8353%-105 - C2 -1PK7 4.7 DEOD_ECO57
70 PsiBlast_CBE 85.8153%-104 - C2 -5IU6 2.9 DEOD_ECOLI
65 PsiBlast_CBE 85.8053% -99 - C2 -1PR0 5.2 DEOD_ECO57
133 PsiBlast_CBE 85.7653%-104 - C2 -1OU4 3.5 DEOD_ECOLI
68 PsiBlast_CBE 85.5853%-102 - C2 -5IU6 2.8 DEOD_ECOLI
137 PsiBlast_CBE 85.4753%-113 - C2 -1A69 4.3 DEOD_ECOLI
124 PsiBlast_CBE 85.4153%-105 - C2 -1PK7 4.7 DEOD_ECO57
73 PsiBlast_CBE 85.3253%-103 - C2 -5I3C 4.1 DEOD_ECOLI
134 PsiBlast_CBE 85.1453% -99 - C2 -1OTY 3.3 DEOD_ECOLI
138 PsiBlast_CBE 85.1053%-105 - C2 -1A69 4.7 DEOD_ECOLI
72 PsiBlast_CBE 84.8453%-102 - C2 -5I3C 4.1 DEOD_ECOLI
67 PsiBlast_CBE 84.8153%-103 - C2 -1PR0 4.8 DEOD_ECO57
119 PsiBlast_CBE 84.7353% -96 - C2 -1PK9 5.5 DEOD_ECO57
116 PsiBlast_CBE 84.6853% -98 - C2 -1PKE 5.1 DEOD_ECO57
56 PsiBlast_CBE 84.6453% -97 - C2 -1PR4 4.8 DEOD_ECO57
88 PsiBlast_CBE 84.4253% -94 - C2 -3UT6 4.5 DEOD_ECOLI
58 PsiBlast_CBE 84.3653%-106 - C2 -1PR4 5.1 DEOD_ECO57
59 PsiBlast_CBE 84.3153% -96 - C2 -1PR2 5.4 DEOD_ECO57
136 PsiBlast_CBE 84.2353%-100 - C2 -1OTY 3.7 DEOD_ECOLI
48 PsiBlast_CBE 84.0853%-103 - C2 -1PW7 4.3 DEOD_ECO57
50 PsiBlast_CBE 83.6453%-101 - C2 -1PR6 4.9 DEOD_ECO57
66 PsiBlast_CBE 83.5053%-102 - C2 -1PR0 4.5 DEOD_ECO57
61 PsiBlast_CBE 83.3753%-100 - C2 -1PR2 5.0 DEOD_ECO57
71 PsiBlast_CBE 83.2953%-101 - C2 -5I3C 4.1 DEOD_ECOLI
54 PsiBlast_CBE 83.2053%-110 - C2 -1PR5 4.7 DEOD_ECO57
55 PsiBlast_CBE 82.9553%-109 - C2 -1PR5 3.7 DEOD_ECO57
52 PsiBlast_CBE 82.8553%-106 - C2 -1PR6 5.0 DEOD_ECO57
62 PsiBlast_CBE 81.8053% -95 - C2 -1PR1 4.5 DEOD_ECO57
64 PsiBlast_CBE 81.4153%-107 - C2 -1PR1 4.4 DEOD_ECO57
157 HHSearch 78.7141% -80 - C2 -1Z34 4.7 ?
53 PsiBlast_CBE 78.0053% -97 - C2 -1PR5 3.9 DEOD_ECO57