@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XYK9: (2018-01-09 )
MKNQYPDLAKQVVFITGAASGIGAAQARAFLEQDAFVFGLDQKFGKMEEISLRFPETFAYALGDVRQMKELQQAVSKCQNHFGEVTILLNTAGILDAYKPLMETDESLWDLIYETNVKSMYQLTKIILPDMIRQKSGTIINMASIAGLIAGGGGIAYTSAKHAIVGFTKQLALDYAGQGIRVKGIAPGAIQTPMNAADFEGKGEMAEWVANETPVKRWAQPEEVAELTLFLASPQASYIQGTIIPIDGGWLLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




GOL_A_6(4FN4)
?
[Raw transfer]




41 PsiBlast_CBE 88.4732%-103 - C1 -3RSH - FABG_VIBCH -
5 PsiBlast_PDB 88.4533%-104 - C1 -3TZH - ? -
7 PsiBlast_PDB 88.3433%-111 - C1 -4WK6 - ? -
12 PsiBlast_PDB 87.6332%-108 - C1 -3TZK - ? -
9 PsiBlast_PDB 87.1732%-102 - C1 -3RRO 2.5 FABG_VIBCH
42 PsiBlast_CBE 87.0832%-103 - C1 -3RRO 2.6 FABG_VIBCH
13 PsiBlast_PDB 86.3432%-102 - C1 -3U09 - FABG_VIBCH -
8 PsiBlast_PDB 86.2932%-102 - C1 -3RSH - FABG_VIBCH -
36 PsiBlast_CBE 86.0333%-114 - C1 -4WK6 - ? -
10 PsiBlast_PDB 85.2632%-107 - C1 -4I08 - FABG_VIBCH -
37 PsiBlast_CBE 84.9933%-116 - C1 -4WK6 - ? -
35 PsiBlast_CBE 84.6833%-116 - C1 -4WK6 - ? -
40 PsiBlast_CBE 84.1932%-102 - C1 -4I08 - FABG_VIBCH -
92 PsiBlast_CBE 82.4532% -70 * C1 *4NBU - ? -
95 PsiBlast_CBE 82.4432% -73 - C1 -4NBU - ? -
93 PsiBlast_CBE 82.2332% -71 - C1 -4NBU - ? -
56 PsiBlast_CBE 82.0234% -77 - C1 -2AG5 - BDH2_HUMAN -
58 PsiBlast_CBE 81.0034% -76 - C1 -2AG5 - BDH2_HUMAN -
55 PsiBlast_CBE 80.6734% -77 - C1 -2AG5 - BDH2_HUMAN -
94 PsiBlast_CBE 80.4832% -70 - C1 -4NBU - ? -