@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XYZ7: (2018-01-11 )
MLKLPEDFIFGGATAAYQVEGATKEGGKGAVAWDDFLEEQGRFSPDPASDFYHQYAKDIELCERFGVNGLRLSIAWSRIFPDGAGKPNPEGIAFYHRVFEECKKRNVTPFVTLHHFDTPKRLFDHGDFLNRETIEAFVSYAIFCFHEFKEVKVWSTFNEIYPVATNQYLLGVFPPGIKYDFTKIVACLHNMMVAHARVVNYFKENELPGEIGVVHSLETKYAATDAPEDKHAAFLDDALSIRFLLDATYLGYYSTETLTALDEICEANQASYHFPEEDFVELKKASTRNDYLGINHYQCHFVKAYDGENAIHHNGTGEKGTSVYKVKGIGERIYKEGIPRTDWDWLIYPEGLYDLLLRIKSDYPHYNKIYITENGMGYKDQFEDGIIMDQPRIDYLRVYLESLSKAITAGVNVKGYFLWSLMDLFSWTNGYNKRYGLFYVDFETQKRYPKESAYWYKLVSETKTII

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BG6_A_3(4ZEP)
?
[Raw transfer]




BGP_B_4(4PBG)
LACG_LACLL
[Raw transfer]




NOJ_A_3(1OIM)
BGLA_THEMA
[Raw transfer]




BGC_A_2(3WH6)
?
[Raw transfer]




BGP_A_3(4ZEN)
?
[Raw transfer]




BGP_A_3(4PBG)
LACG_LACLL
[Raw transfer]




CTS_B_6(2CBU)
BGLA_THEMA
[Raw transfer]




BG6_B_7(4ZEP)
?
[Raw transfer]




BGC_A_4(5AYI)
?
[Raw transfer]




IFL_A_3(1UZ1)
BGLA_THEMA
[Raw transfer]




NOJ_B_4(1OIM)
BGLA_THEMA
[Raw transfer]




IFL_B_4(1UZ1)
BGLA_THEMA
[Raw transfer]




NOY_A_4(2J75)
BGLA_THEMA
[Raw transfer]




CTS_A_3(2CBU)
BGLA_THEMA
[Raw transfer]




BGP_B_14(4ZEN)
?
[Raw transfer]




CGB_B_5(2CBV)
BGLA_THEMA
[Raw transfer]




8P2_B_11(5N6T)
?
[Raw transfer]




CGB_A_3(2CBV)
BGLA_THEMA
[Raw transfer]




OXZ_A_3(1W3J)
BGLA_THEMA
[Raw transfer]




FCB_A_2(3WH7)
?
[Raw transfer]




OXZ_B_4(1W3J)
BGLA_THEMA
[Raw transfer]




IFM_B_4(1OIF)
BGLA_THEMA
[Raw transfer]




AZF_B_7(2J7H)
BGLA_THEMA
[Raw transfer]




8P2_A_7(5N6T)
?
[Raw transfer]




IFM_A_3(1OIF)
BGLA_THEMA
[Raw transfer]




YLL_B_6(2JAL)
BGLA_THEMA
[Raw transfer]




IFM_A_3(3WH8)
?
[Raw transfer]




G2F_A_3(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




G2F_B_4(1OIN)
BGLA_THEMA
[Raw transfer]




34 PsiBlast_PDB 98.9459% -44 - C4 -4PBG 5.4 LACG_LACLL
33 PsiBlast_PDB 98.1059% -47 - C4 -2PBG - LACG_LACLL -
54 PsiBlast_CBE 97.9159% -42 - C4 -4PBG 5.1 LACG_LACLL
32 PsiBlast_PDB 97.8059% -41 - C4 -3PBG - LACG_LACLL -
21 HHSearch 78.9236% -25 - C4 -1E4I 2.1 BGLA_PAEPO
132 PsiBlast_CBE 78.7636% -21 - C4 -3WH8 3.5 ?
134 PsiBlast_CBE 77.2436% -22 - C4 -3WH6 3.7 ?
133 PsiBlast_CBE 77.1036% -20 - C4 -3WH7 3.3 ?
136 PsiBlast_CBE 76.7236% -20 - C4 -5AYB - ? -
18 HHSearch 76.2936% -15 - C4 -5DT7 - ? -
135 PsiBlast_CBE 76.1736% -20 - C4 -3WH5 - ? -
137 PsiBlast_CBE 75.8536% -19 - C4 -5AYI 3.6 ?
56 PsiBlast_CBE 75.4039% -14 - C4 -3AHX - ? -
141 PsiBlast_CBE 75.0935% -20 - C4 -1BGG - BGLA_PAEPO -
139 PsiBlast_CBE 75.0535% -19 - C4 -1BGG - BGLA_PAEPO -
57 PsiBlast_CBE 75.0139% -14 - C4 -3AHX - ? -
138 PsiBlast_CBE 74.9935% -19 - C4 -1UYQ - BGLA_PAEPO -
100 PsiBlast_CBE 74.9835% -11 - C4 -2J78 - BGLA_THEMA -
45 PsiBlast_PDB 74.7835% -9 - C4 -1OIM 4.1 BGLA_THEMA
55 PsiBlast_CBE 74.6839% -11 - C4 -3AHX - ? -
44 PsiBlast_PDB 74.4235% -8 - C4 -1OIF 3.8 BGLA_THEMA
111 PsiBlast_CBE 74.1035% -7 - C4 -1OIN 3.9 BGLA_THEMA
108 PsiBlast_CBE 73.8135% -9 - C4 -2CBU 4.6 BGLA_THEMA
50 PsiBlast_PDB 73.7635% -9 - C4 -2CBV 3.8 BGLA_THEMA
104 PsiBlast_CBE 73.5835% -10 - C4 -2J75 4.4 BGLA_THEMA
72 PsiBlast_CBE 73.5335% -9 - C4 -5N6T 4.3 ?
109 PsiBlast_CBE 73.4735% -9 - C4 -1W3J 3.5 BGLA_THEMA
110 PsiBlast_CBE 73.2035% -5 - C4 -1UZ1 3.8 BGLA_THEMA
113 PsiBlast_CBE 73.1235% -7 - C4 -1OIF 3.5 BGLA_THEMA
46 PsiBlast_PDB 73.1035% -8 - C4 -1OIN 2.9 BGLA_THEMA
112 PsiBlast_CBE 73.0735% -6 - C4 -1OIM 4.2 BGLA_THEMA
107 PsiBlast_CBE 73.0535% -8 - C4 -2CBV 4.2 BGLA_THEMA
48 PsiBlast_PDB 72.9735% -10 - C4 -1UZ1 3.9 BGLA_THEMA
90 PsiBlast_CBE 72.9335% -8 - C4 -2JAL 3.6 BGLA_THEMA
47 PsiBlast_PDB 72.7435% -8 - C4 -1W3J 3.8 BGLA_THEMA
91 PsiBlast_CBE 72.5135% -8 - C4 -2J7H 3.5 BGLA_THEMA
49 PsiBlast_PDB 72.2935% -7 - C4 -2CBU 4.7 BGLA_THEMA
116 PsiBlast_CBE 71.2137% -8 - C4 -4ZEN 3.5 ?
117 PsiBlast_CBE 70.3437% -6 - C4 -4ZEN 3.7 ?
71 PsiBlast_CBE 70.1635% -9 - C4 -5N6T 4.1 ?
114 PsiBlast_CBE 69.9337% -4 - C4 -4ZEP 3.3 ?
115 PsiBlast_CBE 69.8437% -6 - C4 -4ZEP 4.0 ?