@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XZC7: (2018-01-13 )
MGRRLGGKRMEQAYLDLGRKLLEEGHRKEDRTGTGTLSLFGYQMRFDLQKGFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLQNKNHIWDEWAFERYIKSPDYNGPDMTDFGHRCLTDPEFNEEYKKQSKLFCEKILTDDSFAETYGDLGHIYGYQWRHWETKDGGFIDQIKQVIEAIKKTPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVQEGRLSCQLYQRSGDVFLGVPFNIASYALLTHLIAHETGLAVGEFVHTLGDAHLYINHIEQMKEQLSREIRAFPTLVLNQEKQSVFDFEMEDIQLEGYDPHPAIKAPIAV

Atome Classification :

(97 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FOZ_B_7(3UWL)
TYSY_ENTFA
[Raw transfer]




FOZ_B_7(3UWL)
TYSY_ENTFA
[Raw transfer]




U_E_5(1BO8)
TYSY_LACCA
[Raw transfer]




FOZ_D_17(3UWL)
TYSY_ENTFA
[Raw transfer]




THF_B_7(4O7U)
TYSY_ENTFA
[Raw transfer]




U_A_2(1BO7)
TYSY_LACCA
[Raw transfer]




UMP_A_2(3BYX)
TYSY_LACCA
[Raw transfer]




UMP_A_2(1TSX)
TYSY_LACCA
[Raw transfer]




UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_A_2(2TDM)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G86)
TYSY_LACCA
[Raw transfer]




UMP_E_5(1BPJ)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G8A)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G89)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G8D)
TYSY_LACCA
[Raw transfer]




UMP_A_2(3C06)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3BNZ)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMF)
TYSY_LACCA
[Raw transfer]




UMP_B_4(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_A_2(3BZ0)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMI)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TSV)
TYSY_LACCA
[Raw transfer]




UMP_D_10(1J3I)
?
[Raw transfer]




UMP_C_3(1VZB)
TYSY_LACCA
[Raw transfer]




MTX_C_8(5J7W)
TYSY_ENTFA
[Raw transfer]




UMP_B_11(5BY6)
?
[Raw transfer]




UMP_C_3(1TSY)
TYSY_LACCA
[Raw transfer]




UMP_A_3(5H39)
TYSY_HHV8P
[Raw transfer]




DCM_C_3(1NJA)
TYSY_LACCA
[Raw transfer]




UMP_A_5(5BY6)
?
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




UMP_C_3(1VZA)
TYSY_LACCA
[Raw transfer]




TMF_E_5(1LCE)
TYSY_LACCA
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




UMP_E_5(1BP6)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3IK1)
TYSY_LACCA
[Raw transfer]




UFP_C_3(1TDB)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMG)
TYSY_LACCA
[Raw transfer]




CB3_A_3(1LCA)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1NJD)
TYSY_LACCA
[Raw transfer]




DCM_C_3(1NJC)
TYSY_LACCA
[Raw transfer]




UMP_A_2(3C0A)
TYSY_LACCA
[Raw transfer]




UFP_C_3(1VZC)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TDC)
TYSY_LACCA
[Raw transfer]




UMP_E_5(1BP0)
TYSY_LACCA
[Raw transfer]




MTX_D_10(5J7W)
TYSY_ENTFA
[Raw transfer]




UFP_C_3(1VZC)
TYSY_LACCA
[Raw transfer]




DCM_C_3(1NJE)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3IK0)
TYSY_LACCA
[Raw transfer]




CB3_A_3(1VZD)
TYSY_LACCA
[Raw transfer]




DHF_A_3(1LCB)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3IJZ)
TYSY_LACCA
[Raw transfer]




SS7_D_11(4O7U)
TYSY_ENTFA
[Raw transfer]




CB3_E_5(1TVU)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1NJB)
TYSY_LACCA
[Raw transfer]




CB3_E_5(1TVV)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1THY)
TYSY_LACCA
[Raw transfer]




CB3_A_3(1VZE)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMH)
TYSY_LACCA
[Raw transfer]




D16_G_7(1HVY)
TYSY_HUMAN
[Raw transfer]




THF_C_3(2TDD)
TYSY_LACCA
[Raw transfer]




GOL_A_5(1F4B)
TYSY_ECOLI
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




D16_F_6(2KCE)
TYSY_ECOLI
[Raw transfer]




D16_F_6(1RTS)
TYSY_RAT
[Raw transfer]




20C_A_2(3IK1)
TYSY_LACCA
[Raw transfer]




7C1_A_2(3IK0)
TYSY_LACCA
[Raw transfer]




D16_D_4(2KCE)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1TVW)
TYSY_LACCA
[Raw transfer]




C16_A_4(3BNZ)
TYSY_LACCA
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




THG_A_4(3BHL)
TYSY_ECOLI
[Raw transfer]




THG_A_3(3BHR)
TYSY_ECOLI
[Raw transfer]




C2F_B_6(1TLS)
TYSY_ECOLI
[Raw transfer]




MR2_E_5(1TSM)
TYSY_LACCA
[Raw transfer]




C2F_G_7(1TSN)
TYSY_ECOLI
[Raw transfer]




A15_A_3(1TSL)
TYSY_LACCA
[Raw transfer]




LY3_F_6(1JTQ)
TYSY_ECOLI
[Raw transfer]




THG_B_8(3BHL)
TYSY_ECOLI
[Raw transfer]




LY3_D_4(1JTQ)
TYSY_ECOLI
[Raw transfer]




LYD_D_4(1JUT)
TYSY_ECOLI
[Raw transfer]




C2F_A_4(1TLS)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(4KNZ)
TYSY_ECOLI
[Raw transfer]




LYB_F_6(1JTU)
TYSY_ECOLI
[Raw transfer]




NDU_A_4(3B9H)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1KCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1KCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_7(4KNZ)
TYSY_ECOLI
[Raw transfer]




LYB_D_4(1JTU)
TYSY_ECOLI
[Raw transfer]




THG_G_7(1KZI)
TYSY_ECOLI
[Raw transfer]




THG_J_10(1KZI)
TYSY_ECOLI
[Raw transfer]




BME_C_26(2A9W)
TYSY_ECOLI
[Raw transfer]




TP2_B_9(1F4C)
TYSY_ECOLI
[Raw transfer]




LYD_F_6(1JUT)
TYSY_ECOLI
[Raw transfer]




BME_A_20(2A9W)
TYSY_ECOLI
[Raw transfer]




TP3_A_8(1F4F)
TYSY_ECOLI
[Raw transfer]




TPR_A_6(1F4E)
TYSY_ECOLI
[Raw transfer]




TP3_B_9(1F4F)
TYSY_ECOLI
[Raw transfer]




TP2_A_8(1F4C)
TYSY_ECOLI
[Raw transfer]




108 HHSearch 96.6883%-134 - C5 -3UWL 6.0 TYSY_ENTFA
28 PsiBlast_CBE 96.6582%-136 - C5 -3UWL 5.3 TYSY_ENTFA
29 PsiBlast_CBE 96.3182%-134 - C5 -3UWL 6.0 TYSY_ENTFA
22 PsiBlast_CBE 95.6882%-135 - C5 -5J7W 6.6 TYSY_ENTFA
26 PsiBlast_CBE 95.5482%-132 - C5 -4O7U 7.1 TYSY_ENTFA
21 PsiBlast_CBE 95.4582%-127 - C5 -5J7W 6.6 TYSY_ENTFA
24 PsiBlast_CBE 95.3182%-133 - C5 -4O7U 5.4 TYSY_ENTFA
63 PsiBlast_CBE 93.2469%-133 - C5 -1BP6 4.9 TYSY_LACCA
42 PsiBlast_CBE 92.4969%-132 - C5 -1TSX 4.9 TYSY_LACCA
53 PsiBlast_CBE 92.3569%-131 - C5 -1JMH 3.4 TYSY_LACCA
44 PsiBlast_CBE 92.3269%-131 - C5 -1BO7 5.5 TYSY_LACCA
14 PsiBlast_PDB 92.2469%-138 - C5 -3BYX 3.8 TYSY_LACCA
35 PsiBlast_CBE 92.1169%-135 - C5 -1NJD 4.7 TYSY_LACCA
18 PsiBlast_PDB 92.0069%-138 - C5 -3IJZ 3.1 TYSY_LACCA
55 PsiBlast_CBE 91.8469%-136 - C5 -1NJB 3.8 TYSY_LACCA
43 PsiBlast_CBE 91.7769%-130 - C5 -1BO8 4.5 TYSY_LACCA
31 PsiBlast_CBE 91.4069%-131 - C5 -1TSY 4.5 TYSY_LACCA
46 PsiBlast_CBE 91.2869%-133 - C5 -1TSV 5.3 TYSY_LACCA
54 PsiBlast_CBE 91.2569%-133 - C5 -1TVV 4.5 TYSY_LACCA
7 PsiBlast_PDB 91.2569%-129 - C5 -1NJE 4.2 TYSY_LACCA
8 PsiBlast_PDB 91.2269%-131 - C5 -1THY 4.0 TYSY_LACCA
32 PsiBlast_CBE 91.1769%-126 - C5 -2G86 5.5 TYSY_LACCA
50 PsiBlast_CBE 90.8869%-132 - C5 -1BP0 4.7 TYSY_LACCA
51 PsiBlast_CBE 90.8669%-129 - C5 -2G89 4.7 TYSY_LACCA
52 PsiBlast_CBE 90.7669%-136 - C5 -1JMG 3.9 TYSY_LACCA
9 PsiBlast_PDB 90.7569%-131 - C5 -1TSL 5.1 TYSY_LACCA
62 PsiBlast_CBE 90.4769%-129 - C5 -1BPJ 3.9 TYSY_LACCA
20 PsiBlast_PDB 90.3269%-136 - C5 -3IK1 3.8 TYSY_LACCA
11 PsiBlast_PDB 90.1769%-123 - C5 -2TDM 5.8 TYSY_LACCA
10 PsiBlast_PDB 90.1569%-128 - C5 -1TSM 3.0 TYSY_LACCA
6 PsiBlast_PDB 90.0869%-125 - C5 -1LCE 5.0 TYSY_LACCA
34 PsiBlast_CBE 90.0369%-128 - C5 -1JMI 4.3 TYSY_LACCA
60 PsiBlast_CBE 89.9769%-125 - C5 -1VZB 4.2 TYSY_LACCA
49 PsiBlast_CBE 89.9469%-125 - C5 -2G8A 5.3 TYSY_LACCA
47 PsiBlast_CBE 89.8769%-130 - C5 -1TVU 5.9 TYSY_LACCA
57 PsiBlast_CBE 89.7469%-132 - C5 -1VZE 4.0 TYSY_LACCA
13 PsiBlast_PDB 89.7169%-129 - C5 -3BNZ 4.0 TYSY_LACCA
48 PsiBlast_CBE 89.5669%-134 - C5 -1JMF 4.2 TYSY_LACCA
36 PsiBlast_CBE 89.4169%-131 - C5 -1NJC 4.9 TYSY_LACCA
37 PsiBlast_CBE 89.3669%-124 - C5 -2TDD 3.2 TYSY_LACCA
38 PsiBlast_CBE 89.3569%-123 - C5 -2G8D 4.8 TYSY_LACCA
56 PsiBlast_CBE 89.3269%-129 - C5 -1NJA 4.6 TYSY_LACCA
33 PsiBlast_CBE 89.2569%-128 - C5 -1TVW 4.6 TYSY_LACCA
4 PsiBlast_PDB 89.1569%-121 - C5 -1LCA 4.9 TYSY_LACCA
39 PsiBlast_CBE 88.9969%-129 - C5 -1TDC 3.8 TYSY_LACCA
19 PsiBlast_PDB 88.9869%-132 - C5 -3IK0 4.0 TYSY_LACCA
107 HHSearch 88.9569%-134 - C5 -1VZC 4.3 TYSY_LACCA
59 PsiBlast_CBE 88.9569%-134 - C5 -1VZC 4.3 TYSY_LACCA
65 PsiBlast_CBE 88.7666%-134 - C5 -4DQ1 4.8 TYSY_STAAM
40 PsiBlast_CBE 88.5469%-127 - C5 -1TDB 3.1 TYSY_LACCA
15 PsiBlast_PDB 88.5269%-133 - C5 -3BZ0 3.4 TYSY_LACCA
16 PsiBlast_PDB 88.3369%-126 - C5 -3C06 4.4 TYSY_LACCA
61 PsiBlast_CBE 88.0969%-124 - C5 -1VZA 4.4 TYSY_LACCA
58 PsiBlast_CBE 87.4769%-123 - C5 -1VZD 4.5 TYSY_LACCA
5 PsiBlast_PDB 87.2969%-125 - C5 -1LCB 4.5 TYSY_LACCA
64 PsiBlast_CBE 87.2466%-134 - C5 -4DQ1 5.1 TYSY_STAAM
17 PsiBlast_PDB 86.4169%-139 - C5 -3C0A 4.2 TYSY_LACCA
120 HHSearch 79.8360%-136 - C5 -4FQS 4.5 TYSY_MYCTU
106 PsiBlast_CBE 76.6650%-140 - C5 -2KCE 6.4 TYSY_ECOLI
105 PsiBlast_CBE 75.0250%-136 - C5 -2KCE 5.1 TYSY_ECOLI
117 HHSearch 72.5854% -48 - C5 -1HVY 5.1 TYSY_HUMAN
111 HHSearch 70.4355% -53 - C5 -4EZ8 6.4 TYSY_MOUSE
122 HHSearch 69.8155% -49 - C5 -1RTS 5.1 TYSY_RAT
109 HHSearch 68.9644% -55 - C5 -1J3K 5.4 ?
110 HHSearch 68.3644% -52 - C5 -1J3I 5.4 ?
121 HHSearch 68.2450% -56 - C5 -5H39 5.4 TYSY_HHV8P
116 HHSearch 64.3648% -14 - C5 -5BY6 5.4 ?
115 HHSearch 64.2948% -11 - C5 -5BY6 5.7 ?
123 HHSearch 61.2337% -48 - C5 -3V8H 2.3 ?
76 PsiBlast_CBE 45.4850% -17 - C5 -3BHR 0.5 TYSY_ECOLI
96 PsiBlast_CBE 45.1750% -21 - C5 -1JTQ 1.8 TYSY_ECOLI
95 PsiBlast_CBE 44.8950% -19 - C5 -1JTU Error TYSY_ECOLI
77 PsiBlast_CBE 44.7150% -16 - C5 -3BHL 1.9 TYSY_ECOLI
66 PsiBlast_CBE 44.6050% -16 - C5 -4KNZ 1.2 TYSY_ECOLI
93 PsiBlast_CBE 44.5950% -16 - C5 -1JUT 2.0 TYSY_ECOLI
85 PsiBlast_CBE 44.5550% -9 - C5 -1TSN 3.9 TYSY_ECOLI
89 PsiBlast_CBE 44.5350% -19 - C5 -1KZI 3.4 TYSY_ECOLI
78 PsiBlast_CBE 44.4250% -13 - C5 -3BHL 2.6 TYSY_ECOLI
88 PsiBlast_CBE 44.3750% -20 - C5 -1KZI 6.2 TYSY_ECOLI
67 PsiBlast_CBE 44.3350% -14 - C5 -4KNZ 2.7 TYSY_ECOLI
86 PsiBlast_CBE 44.2550% -18 - C5 -1TLS 0.9 TYSY_ECOLI
91 PsiBlast_CBE 44.2150% -15 - C5 -1KCE 3.0 TYSY_ECOLI
87 PsiBlast_CBE 44.2050% -11 - C5 -1TLS 0.9 TYSY_ECOLI
103 PsiBlast_CBE 44.1050% -18 - C5 -1F4B 1.3 TYSY_ECOLI
100 PsiBlast_CBE 43.9050% -19 - C5 -1F4E 2.7 TYSY_ECOLI
90 PsiBlast_CBE 43.9050% -19 - C5 -1KCE 0.8 TYSY_ECOLI
79 PsiBlast_CBE 43.7750% -18 - C5 -3B9H Error TYSY_ECOLI
99 PsiBlast_CBE 43.6250% -18 - C5 -1F4F 0.6 TYSY_ECOLI
92 PsiBlast_CBE 43.5950% -18 - C5 -1JUT 2.2 TYSY_ECOLI
94 PsiBlast_CBE 43.4550% -18 - C5 -1JTU 0.9 TYSY_ECOLI
84 PsiBlast_CBE 43.3650% -19 - C5 -2A9W 2.2 TYSY_ECOLI
81 PsiBlast_CBE 43.2650% -16 - C5 -2A9W 1.5 TYSY_ECOLI
98 PsiBlast_CBE 43.2050% -18 - C5 -1F4F Error TYSY_ECOLI
97 PsiBlast_CBE 43.0650% -15 - C5 -1JTQ 2.4 TYSY_ECOLI
101 PsiBlast_CBE 42.8750% -14 - C5 -1F4C 1.2 TYSY_ECOLI
82 PsiBlast_CBE 42.8250% -20 - C5 -2A9W 1.1 TYSY_ECOLI
102 PsiBlast_CBE 42.2950% -19 - C5 -1F4C 1.3 TYSY_ECOLI