@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XZP1: (2018-01-15 )
MSLIGKKIEEFNAHAYHQGEFLEVSEKDLMGNWSILCFYPADFTFVCPTELEDLQEQYSTLKSLGVEVFSCSTDTHFTHKAWHDTSDAIGKIEYVMIGDPSHQISRIFDVLDEEQGLAQRGTFIIDPDGIVQAMEINADGIGRDASALIDKIRAAQYVRTHPGEVCPAKWKESGETLKPSFDLVGKI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CPS_A_8(4XCS)
PRDX1_HUMAN
[Raw transfer]



CPS_E_11(4XCS)
PRDX1_HUMAN
[Raw transfer]



GOL_C_8(3QPM)
?
[Raw transfer]



GOL_D_9(3QPM)
?
[Raw transfer]
26 PsiBlast_CBE 92.9262%-110 - C1 -4MA9 - AHPC_SALTY -
178 HHSearch 92.9162%-107 - C1 -1N8J - AHPC_SALTY -
25 PsiBlast_CBE 92.8862%-114 - C1 -4MA9 - AHPC_SALTY -
15 PsiBlast_PDB 92.4062%-109 - C1 -1N8J - AHPC_SALTY -
79 PsiBlast_CBE 91.9962%-110 - C1 -4MAB - AHPC_SALTY -
179 HHSearch 91.8262%-110 - C1 -4XRA - AHPC_SALTY -
24 PsiBlast_CBE 91.0562%-111 - C1 -4MA9 - AHPC_SALTY -
80 PsiBlast_CBE 90.6862%-107 - C1 -4MAB - AHPC_SALTY -
78 PsiBlast_CBE 89.2562%-106 - C1 -4MAB - AHPC_SALTY -
77 PsiBlast_CBE 88.5562%-107 - C1 -4MAB - AHPC_SALTY -
12 PsiBlast_PDB 87.7662%-107 - C1 -1YF0 - AHPC_SALTY -
13 PsiBlast_PDB 86.9862%-109 - C1 -1YEX - AHPC_SALTY -
14 PsiBlast_PDB 86.7062%-116 - C1 -4MAB - AHPC_SALTY -
3 PsiBlast_PDB 85.8562%-106 - C1 -1YEP - AHPC_SALTY -
8 PsiBlast_PDB 85.5962%-111 - C1 -4XRA - AHPC_SALTY -
9 PsiBlast_PDB 84.8762%-110 - C1 -1YF1 - AHPC_SALTY -
5 PsiBlast_PDB 84.8461%-112 - C1 -5B8A - AHPC_ECOLI (first) -
17 PsiBlast_PDB 84.5962%-110 - C1 -4XS4 - AHPC_SALTY -
10 PsiBlast_PDB 84.5862%-110 - C1 -4XS1 - AHPC_SALTY -
16 PsiBlast_PDB 84.5362%-110 - C1 -3EMP - AHPC_SALTY -