@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XZS0: (2018-01-16 )
MKIKAALFDLDGVLVDTARYHYEAWLVLANQLSIPFTEKENEQLKGISRTESLERLLSFGKMEQKFSEKEKSAFAEQKNNLYLQAIQKMDETSVLPGAIAVLEYLKKTNIKIGLGSASKNARLILEKTNLTSYFDVLIDGTQVSKAKPDPEVFLKGAQQLNVPPNACLVIEDSEAGCQAALAGNMHVLGIGENINLPSAEYVIPDLTVFDQVRSFWHLSEAVSRI

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G16_A_2(1O08)
PGMB_LACLA
[Raw transfer]




G16_A_2(1O03)
PGMB_LACLA
[Raw transfer]




BG6_A_4(2WF6)
PGMB_LACLA
[Raw transfer]




BG6_A_3(3ZI4)
PGMB_LACLA
[Raw transfer]




BG6_A_2(2WF5)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4N)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4T)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4N)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4O)
PGMB_LACLA
[Raw transfer]




G6P_A_3(2WF9)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4S)
PGMB_LACLA
[Raw transfer]




G1P_A_4(2WF8)
PGMB_LACLA
[Raw transfer]




YO5_A_3(4C4R)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4O)
PGMB_LACLA
[Raw transfer]




MGF_A_4(4C4R)
PGMB_LACLA
[Raw transfer]




3 PsiBlast_PDB 91.7441%-122 - C1 -4G9B - PGMB_ECOLI -
32 HHSearch 90.1640%-125 - C1 -4G9B - PGMB_ECOLI -
27 HHSearch 86.2744% -99 - C1 -4GIB - ? -
2 PsiBlast_PDB 85.8543%-146 - C1 -3NAS - PGMB_BACSU -
29 HHSearch 84.9142%-147 - C1 -3NAS - PGMB_BACSU -
28 HHSearch 84.6042%-147 - C1 -3NAS - PGMB_BACSU -
21 PsiBlast_CBE 83.4646% -98 - C1 -4GIB - ? -
1 PsiBlast_PDB 82.9046% -95 - C1 -4GIB - ? -
8 PsiBlast_PDB 75.7639% -15 - C1 -1ZOL - PGMB_LACLA -
10 PsiBlast_PDB 75.1239% -11 - C1 -2WHE - PGMB_LACLA -
15 PsiBlast_PDB 73.0939% -8 - C1 -2WFA - PGMB_LACLA -
20 PsiBlast_PDB 72.8939% -8 - C1 -3FM9 - PGMB_LACLA -
14 PsiBlast_PDB 71.6239% -1 - C1 -2WF9 4.4 PGMB_LACLA
16 PsiBlast_PDB 71.1839% -1 - C1 -3ZI4 5.7 PGMB_LACLA
5 PsiBlast_PDB 70.6339% -2 - C1 -1O08 6.5 PGMB_LACLA
12 PsiBlast_PDB 70.5739% 2 - C1 -2WF6 5.1 PGMB_LACLA
9 PsiBlast_PDB 70.2739% 1 - C1 -2WF5 5.5 PGMB_LACLA
6 PsiBlast_PDB 70.0239% -0 - C1 -1Z4N 4.9 PGMB_LACLA
17 PsiBlast_PDB 69.9039% 3 - C1 -4C4R 6.5 PGMB_LACLA
4 PsiBlast_PDB 69.8739% 1 - C1 -1O03 6.6 PGMB_LACLA
7 PsiBlast_PDB 69.7739% 3 - C1 -1Z4O 5.5 PGMB_LACLA
11 PsiBlast_PDB 69.4339% 4 - C1 -2WF7 5.3 PGMB_LACLA
13 PsiBlast_PDB 69.1739% 4 - C1 -2WF8 4.6 PGMB_LACLA
22 PsiBlast_CBE 68.9439% -2 - C1 -1Z4O 5.2 PGMB_LACLA
31 HHSearch 68.8340% 3 - C1 -2WF7 5.3 PGMB_LACLA
18 PsiBlast_PDB 68.5439% 4 - C1 -4C4S 6.6 PGMB_LACLA
19 PsiBlast_PDB 68.4739% 7 - C1 -4C4T 6.6 PGMB_LACLA
23 PsiBlast_CBE 64.1439% 13 - C1 -1Z4N 5.0 PGMB_LACLA