@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XZX4: (2018-01-17 )
MEKKELLYEGKAKKIYLTSDENLIWIEYLDQATALNGARKDQISGKGELNNQITSAIFRYLTQRGIKNHFIEQLSKTEQLAKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKEFIKPIIEFYYKDDQLDDPFINEEHIYFLQLAKPEEISELKAQALAINEILTELFAKVGLVLVDFKLEFGRSNGQILLADEVTPDTCRLWDERTNEHMDKDVYRRDLGDLIPVYQEVYNRLSELTEEKERV

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_8(3NUA)
PUR7_CLOP1
[Raw transfer]




ADP_B_8(3NUA)
PUR7_CLOP1
[Raw transfer]




AMP_A_11(4O81)
PUR7_PYRHO
[Raw transfer]




C5P_A_2(4O7Y)
PUR7_PYRHO
[Raw transfer]




AIR_A_3(4FE2)
PUR7_STRPN
[Raw transfer]




AIR_A_3(4FE2)
PUR7_STRPN
[Raw transfer]




C2R_B_12(2GQS)
PUR7_ECOLI
[Raw transfer]




C2R_B_12(2GQS)
PUR7_ECOLI
[Raw transfer]




C2R_A_10(2GQS)
PUR7_ECOLI
[Raw transfer]




C2R_A_10(2GQS)
PUR7_ECOLI
[Raw transfer]




TYD_A_2(4O7S)
PUR7_PYRHO
[Raw transfer]




U5P_A_2(4O7R)
PUR7_PYRHO
[Raw transfer]




ATP_A_7(2Z02)
PUR7_METJA
[Raw transfer]




ATP_A_7(2Z02)
PUR7_METJA
[Raw transfer]




EDO_A_7(3KRE)
PUR7_EHRCR
[Raw transfer]




ATP_A_3(4O7W)
PUR7_PYRHO
[Raw transfer]




EDO_A_7(3KRE)
PUR7_EHRCR
[Raw transfer]




ADP_A_4(4FGR)
PUR7_STRPN
[Raw transfer]




ATP_B_6(2Z02)
PUR7_METJA
[Raw transfer]




ADP_B_13(2YWV)
?
[Raw transfer]




ADP_A_4(4NYE)
PUR7_STRPN
[Raw transfer]




ADP_A_4(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_B_13(2YWV)
?
[Raw transfer]




ADP_A_3(4O7V)
PUR7_PYRHO
[Raw transfer]




ADP_A_3(4O7T)
PUR7_PYRHO
[Raw transfer]




ADP_A_4(2YZL)
PUR7_METJA
[Raw transfer]




ADP_A_3(3NUA)
PUR7_CLOP1
[Raw transfer]




EDO_A_4(3KRE)
PUR7_EHRCR
[Raw transfer]




ADP_A_5(4O7N)
PUR7_PYRHO
[Raw transfer]




ADP_A_8(4O86)
PUR7_PYRHO
[Raw transfer]




ADP_B_8(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_B_12(4FE2)
PUR7_STRPN
[Raw transfer]




MRD_A_3(3R9R)
PUR7_MYCA9
[Raw transfer]




ADP_B_8(4NYE)
PUR7_STRPN
[Raw transfer]




AMP_A_12(4O83)
PUR7_PYRHO
[Raw transfer]




ADP_A_10(4O82)
PUR7_PYRHO
[Raw transfer]




34 HHSearch 85.7556% -35 - C3 -2YWV 7.0 ?
21 PsiBlast_CBE 84.8856% -36 - C3 -2YWV 7.0 ?
1 PsiBlast_PDB 84.3456% -36 - C3 -2YWV - ? -
4 PsiBlast_PDB 83.6460% -28 - C3 -4NYE 7.1 PUR7_STRPN
3 PsiBlast_PDB 83.5560% -27 - C3 -4FGR 7.2 PUR7_STRPN
2 PsiBlast_PDB 83.2060% -26 - C3 -4FE2 5.1 PUR7_STRPN
39 HHSearch 82.9461% -30 - C3 -4FGR 7.2 PUR7_STRPN
33 HHSearch 82.8454% -69 - C3 -3NUA 6.5 PUR7_CLOP1
5 PsiBlast_PDB 82.6954% -76 - C3 -3NUA 8.2 PUR7_CLOP1
38 HHSearch 82.5861% -30 - C3 -4FE2 5.1 PUR7_STRPN
24 PsiBlast_CBE 82.5360% -26 - C3 -4FE2 6.3 PUR7_STRPN
25 PsiBlast_CBE 82.3254% -74 - C3 -3NUA 6.5 PUR7_CLOP1
31 HHSearch 80.8941% -58 - C3 -2GQR - PUR7_ECOLI -
37 HHSearch 80.7150% -45 - C3 -3KRE 3.2 PUR7_EHRCR
6 PsiBlast_PDB 80.3149% -43 - C3 -3KRE 3.2 PUR7_EHRCR
28 PsiBlast_CBE 80.2248% -46 - C3 -2YZL 6.3 PUR7_METJA
22 PsiBlast_CBE 79.9960% -26 - C3 -4NYE 6.3 PUR7_STRPN
7 PsiBlast_PDB 79.9349% -51 - C3 -3U55 - PUR7_PYRHO -
30 PsiBlast_CBE 79.8041% -55 - C3 -2GQS 5.6 PUR7_ECOLI
23 PsiBlast_CBE 79.6560% -27 - C3 -4FGR 6.5 PUR7_STRPN
32 HHSearch 79.4041% -59 - C3 -2GQS 5.6 PUR7_ECOLI
20 PsiBlast_PDB 79.4049% -63 - C3 -4O83 4.1 PUR7_PYRHO
29 PsiBlast_CBE 79.3741% -60 * C3 *2GQS 5.6 PUR7_ECOLI
19 PsiBlast_PDB 79.2349% -62 - C3 -4O82 5.5 PUR7_PYRHO
50 Fugue 79.1440% -54 - C3 -2GQS 5.6 PUR7_ECOLI
14 PsiBlast_PDB 79.0949% -50 - C3 -4O7W 5.3 PUR7_PYRHO
40 HHSearch 79.0548% -44 - C3 -2Z02 6.2 PUR7_METJA
18 PsiBlast_PDB 78.9849% -61 - C3 -4O81 6.4 PUR7_PYRHO
16 PsiBlast_PDB 78.8549% -52 - C3 -4O86 5.2 PUR7_PYRHO
11 PsiBlast_PDB 78.3049% -67 - C3 -4O7S 6.3 PUR7_PYRHO
27 PsiBlast_CBE 77.9548% -43 - C3 -2Z02 6.5 PUR7_METJA
10 PsiBlast_PDB 77.8449% -49 - C3 -4O7R 5.7 PUR7_PYRHO
35 HHSearch 77.7247% -44 - C3 -4O7N 6.5 PUR7_PYRHO
26 PsiBlast_CBE 77.7248% -46 - C3 -2Z02 6.9 PUR7_METJA
12 PsiBlast_PDB 77.6049% -54 - C3 -4O7T 5.3 PUR7_PYRHO
13 PsiBlast_PDB 77.4949% -54 - C3 -4O7V 4.5 PUR7_PYRHO
15 PsiBlast_PDB 76.6149% -53 - C3 -4O7Y 5.7 PUR7_PYRHO