@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y008: (2018-01-18 )
MREKTDTLPKATAKRLPLYLRYLKMLDDSGISRIKSNEFSEITQIPSATIRRDFSQLGELGRSGYGYDVPFLIDVFNNILNTKEEKRIALVGYGNLGKALKHNNFRRNENLNIVCVFDNDPALINRVIDGEMIYPIDRFAEIAKAKNVTVAISTVPSKYSQSAIDEIVKGNVTAILNFAPDRVTVPAYVNVQYIDLTTELQTLIYFDENYSEVFS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_4(3KET)
REX_STRA3
[Raw transfer]




NAD_A_5(3IKT)
REX_THET2
[Raw transfer]




21 PsiBlast_CBE 82.4243%-156 - C7 -2VT3 - REX_BACSU -
3 PsiBlast_PDB 79.4043% -87 - C7 -3KEO - REX_STRA3 -
5 PsiBlast_PDB 79.3043% -82 - C7 -3KET 9.8 REX_STRA3
22 PsiBlast_CBE 79.1343%-160 - C7 -2VT2 - REX_BACSU -
24 PsiBlast_CBE 78.8843% -87 - C7 -3KEO - REX_STRA3 -
23 PsiBlast_CBE 78.3443% -88 - C7 -3KEQ - REX_STRA3 -
45 HHSearch 77.9042% -86 - C7 -3KEO - REX_STRA3 -
14 PsiBlast_PDB 77.8229%-159 - C7 -3WGI - ? -
64 Fugue 77.1443%-199 - C7 -2VT3 - REX_BACSU -
12 PsiBlast_PDB 77.1329%-160 - C7 -3WGG - ? -
4 PsiBlast_PDB 76.7343% -96 - C7 -3KEQ - REX_STRA3 -
46 HHSearch 76.7143%-196 - C7 -2VT3 - REX_BACSU -
1 PsiBlast_PDB 76.6243%-190 - C7 -2VT2 - REX_BACSU -
2 PsiBlast_PDB 76.4943%-192 - C7 -2VT3 - REX_BACSU -
49 HHSearch 75.5128%-157 - C7 -3WGI - ? -
13 PsiBlast_PDB 75.4629%-170 - C7 -3WGH - ? -
48 HHSearch 75.1228%-163 * C7 *3WG9 - ? -
43 HHSearch 74.6631%-160 - C7 -2DT5 - REX_THET8 -
11 PsiBlast_PDB 74.4629%-160 - C7 -3WG9 - ? -
47 HHSearch 74.1743% -68 - C7 -2VT3 - REX_BACSU -