@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y0S7: (2018-01-22 )
MEQFGMITATASVLPEKIITNNDLSKMMDTSDEWISSRTGIRERRCVTNQETSDLCILVAEKLIKQKNLNPKDLDFILVATMSPDYTTPSVAAQVQGKLGATHAIAFDISAACSGFVYALSMAEKMIRCGSTKGLVIGGETLSKLIDWSDRTTAVLFGDGAGGILLEANPQKKLLKEKLAADGTRSSSLTAGYQQNKNPFYSEDSEGSYYLQMTGRDIFDFAVRDVANNIQEVMKDKPVDYLLLHQANLRIIEKIARKVKMPQEKFLTNMDKYGNTSAASIPILLDEAVSSGKITLGKQQKVIFTGYGGGLTWGSILMEL

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_C_3(1HND)
FABH_ECOLI
[Raw transfer]




CO8_A_4(5V0P)
FABH2_VIBCH
[Raw transfer]




ACO_A_5(3IL4)
FABH_ENTFA
[Raw transfer]




CO8_B_6(5V0P)
FABH2_VIBCH
[Raw transfer]




COA_A_5(2EFT)
FABH_ECOLI
[Raw transfer]




COA_A_5(2GYO)
FABH_ECOLI
[Raw transfer]




COA_A_5(2GYO)
FABH_ECOLI
[Raw transfer]




4VK_A_4(5BNM)
FABH_ECOLI
[Raw transfer]




4VN_A_4(5BQS)
FABH_STRZP
[Raw transfer]




4LB_B_5(4Z8D)
FABH_ECOLI
[Raw transfer]




4VM_B_4(5BNS)
FABH_ECOLI
[Raw transfer]




B82_C_7(3IL5)
FABH_ENTFA
[Raw transfer]




4VM_A_3(5BNS)
FABH_ECOLI
[Raw transfer]




COA_D_4(1MZJ)
FABH_STRLI
[Raw transfer]




COA_A_3(1EBL)
FABH_ECOLI
[Raw transfer]




B82_A_5(3IL5)
FABH_ENTFA
[Raw transfer]




4LB_A_3(4Z8D)
FABH_ECOLI
[Raw transfer]




4VN_B_6(5BQS)
FABH_STRZP
[Raw transfer]




PG4_B_5(5BNM)
FABH_ECOLI
[Raw transfer]




4VN_B_6(5BQS)
FABH_STRZP
[Raw transfer]




B82_B_6(3IL5)
FABH_ENTFA
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




B82_D_8(3IL5)
FABH_ENTFA
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




COA_B_3(5KP2)
FABH2_VIBCH
[Raw transfer]




BE2_A_3(3H78)
PQSD_PSEAE
[Raw transfer]




BE2_B_4(3H78)
PQSD_PSEAE
[Raw transfer]




ACE_F_6(1MZJ)
FABH_STRLI
[Raw transfer]




ACE_E_5(1MZJ)
FABH_STRLI
[Raw transfer]




22 PsiBlast_CBE 98.6262% -60 - C2 -3IL5 4.5 FABH_ENTFA
21 PsiBlast_CBE 98.3762% -63 - C2 -3IL5 4.9 FABH_ENTFA
1 PsiBlast_PDB 98.0362% -65 - C2 -3IL5 5.4 FABH_ENTFA
23 PsiBlast_CBE 95.9062% -57 - C2 -3IL5 4.9 FABH_ENTFA
2 PsiBlast_PDB 93.7861% -61 - C2 -3IL4 7.1 FABH_ENTFA
84 HHSearch 88.2854% -42 - C2 -5BQS 6.8 FABH_STRZP
24 PsiBlast_CBE 87.9753% -40 - C2 -5BQS 6.7 FABH_STRZP
3 PsiBlast_PDB 87.6253% -42 - C2 -5BQS 6.2 FABH_STRZP
27 PsiBlast_CBE 84.7041% -27 - C2 -4Z8D 6.2 FABH_ECOLI
19 PsiBlast_PDB 83.8940% -27 - C2 -1EBL 3.1 FABH_ECOLI
7 PsiBlast_PDB 83.8341% -25 - C2 -1HND 8.5 FABH_ECOLI
28 PsiBlast_CBE 83.6041% -30 - C2 -2GYO - FABH_ECOLI -
13 PsiBlast_PDB 83.5541% -28 - C2 -5BNM 6.6 FABH_ECOLI
10 PsiBlast_PDB 83.2341% -27 - C2 -2EFT 8.3 FABH_ECOLI
31 PsiBlast_CBE 83.1638% -58 - C2 -4X0O - FABH2_VIBCH -
6 PsiBlast_PDB 83.1441% -24 - C2 -1HN9 - FABH_ECOLI -
26 PsiBlast_CBE 83.0841% -29 - C2 -5BNM 3.5 FABH_ECOLI
8 PsiBlast_PDB 83.0041% -29 - C2 -1HNJ 9.0 FABH_ECOLI
12 PsiBlast_PDB 82.9541% -28 - C2 -4Z8D 6.4 FABH_ECOLI
14 PsiBlast_PDB 82.8741% -28 - C2 -5BNS 9.7 FABH_ECOLI
69 HHSearch 82.5641% -30 - C2 -1HNJ 9.0 FABH_ECOLI
40 PsiBlast_CBE 82.5537% -54 - C2 -5V0P 9.6 FABH2_VIBCH
25 PsiBlast_CBE 82.2241% -28 - C2 -5BNS 10.6 FABH_ECOLI
11 PsiBlast_PDB 82.1141% -29 - C2 -2GYO 7.7 FABH_ECOLI
39 PsiBlast_CBE 82.1037% -54 - C2 -5V0P 10.1 FABH2_VIBCH
68 HHSearch 81.2441% -29 - C2 -2GYO 7.7 FABH_ECOLI
41 PsiBlast_CBE 80.3437% -59 - C2 -5KP2 5.3 FABH2_VIBCH
53 Fugue 79.0541% -2 - C2 -1HNJ 8.9 FABH_ECOLI
50 PsiBlast_CBE 71.7231% -25 - C2 -1MZJ 2.8 FABH_STRLI
51 PsiBlast_CBE 71.5231% -28 - C2 -1MZJ 2.3 FABH_STRLI