@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y199: (2018-01-24 )
MRYPILIHPNDKLKRTAQPIDVITDETIALLDNLYETMIANDGIGIAAPQVGQNKRIAVIEVDEGEKFELINPEIIEAKGESLDVEGCLSIPHVYGTVKRADEVTVRYYDRDGEEIEVTAFGYLARAFQHEIDHLDGILFIEKMIQQIPEEELEEYMEEHLDD

Atome Classification :

(65 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BB2_A_3(1WS1)
DEF1_BACCR
[Raw transfer]




2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_C_10(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_D_12(4WXL)
DEF_HAEI8
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




BB2_B_8(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_6(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_A_7(4DR9)
?
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




MLN_A_4(1BSK)
DEF_ECOLI
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




FMT_A_3(1XEN)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_D_12(4WXK)
DEF_HAEI8
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




GOL_B_6(1N5N)
DEF_PSEAE
[Raw transfer]




GOL_A_5(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_B_11(4DR8)
?
[Raw transfer]




GOL_A_5(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




GOL_B_8(4WXK)
DEF_HAEI8
[Raw transfer]




FMT_A_5(1XEN)
DEF_ECOLI
[Raw transfer]




BB4_A_8(3O3J)
DEF1B_ARATH
[Raw transfer]




Y12_A_3(2EW5)
?
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




FMT_D_16(4DR8)
?
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




Y12_A_3(2EW5)
?
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




EDO_B_10(4DR8)
?
[Raw transfer]




EDO_B_10(4DR8)
?
[Raw transfer]




144 HHSearch 87.6045% -56 - C7 -1WS0 - DEF1_BACCR -
22 PsiBlast_CBE 83.5747% -30 - C7 -4WXL 5.8 DEF_HAEI8
63 PsiBlast_CBE 82.1242% -39 - C7 -1S17 3.9 DEF_PSEAE
26 PsiBlast_CBE 81.9847% -40 - C7 -4WXK 2.3 DEF_HAEI8
1 PsiBlast_PDB 81.9347% -32 - C7 -4WXK 2.4 DEF_HAEI8
65 PsiBlast_CBE 81.4542% -32 - C7 -1N5N 2.4 DEF_PSEAE
155 Fugue 81.2142% -36 - C7 -1G2A 6.1 DEF_ECOLI
21 PsiBlast_CBE 81.1147% -43 - C7 -4WXL 5.7 DEF_HAEI8
136 HHSearch 80.9240% -14 - C7 -1XEO 3.5 DEF_ECOLI
2 PsiBlast_PDB 80.3447% -30 - C7 -4WXL 6.0 DEF_HAEI8
67 PsiBlast_CBE 80.2442% -31 - C7 -1IX1 - DEF_PSEAE -
68 PsiBlast_CBE 79.7742% -37 - C7 -1IX1 - DEF_PSEAE -
62 PsiBlast_CBE 79.7642% -42 - C7 -1S17 4.4 DEF_PSEAE
24 PsiBlast_CBE 79.6447% -34 - C7 -4WXK 3.4 DEF_HAEI8
23 PsiBlast_CBE 79.6147% -35 - C7 -4WXL 5.8 DEF_HAEI8
3 PsiBlast_PDB 79.5745% -43 - C7 -1WS0 - DEF1_BACCR -
64 PsiBlast_CBE 79.4142% -40 - C7 -1N5N 2.3 DEF_PSEAE
154 Fugue 79.3740% -3 - C7 -1BS4 - DEF_ECOLI -
143 HHSearch 79.0538% -14 - C7 -1N5N 2.1 DEF_PSEAE
46 PsiBlast_CBE 79.0545% -15 - C7 -1BSZ 5.3 DEF_ECOLI
148 HHSearch 78.6640% -18 - C7 -2W3T 2.4 DEF_ECOLI
150 HHSearch 78.6439% -33 - C7 -4DR8 2.9 ?
151 HHSearch 78.3139% -29 - C7 -4DR8 3.3 ?
27 PsiBlast_CBE 77.7945% -16 - C7 -4AL2 2.8 DEF_ECOLI
15 PsiBlast_PDB 77.2345% -9 - C7 -1BSZ 5.1 DEF_ECOLI
36 PsiBlast_CBE 77.1145% -11 - C7 -1XEM 3.6 DEF_ECOLI
9 PsiBlast_PDB 77.1045% -11 - C7 -1ICJ 5.4 DEF_ECOLI
39 PsiBlast_CBE 76.9345% -14 - C7 -1ICJ 5.5 DEF_ECOLI
4 PsiBlast_PDB 76.6645% -30 - C7 -1WS1 6.6 DEF1_BACCR
34 PsiBlast_CBE 76.5945% -11 - C7 -1XEO 3.5 DEF_ECOLI
56 PsiBlast_CBE 76.5045% -14 - C7 -1BS4 4.7 DEF_ECOLI
37 PsiBlast_CBE 76.5045% -15 - C7 -1LRU 5.5 DEF_ECOLI
73 PsiBlast_CBE 76.1341% -30 - C7 -4DR8 3.1 ?
156 Fugue 75.8738% -14 - C7 -1G2A 6.1 DEF_ECOLI
5 PsiBlast_PDB 75.8445% -19 - C7 -4AL2 2.8 DEF_ECOLI
31 PsiBlast_CBE 75.8345% -13 - C7 -2AI8 3.9 DEF_ECOLI
141 HHSearch 75.7536% -33 - C7 -2EW5 6.3 ?
35 PsiBlast_CBE 75.7245% -12 - C7 -1XEN 3.5 DEF_ECOLI
30 PsiBlast_CBE 75.6345% -15 - C7 -3K6L 4.8 DEF_ECOLI
28 PsiBlast_CBE 75.6245% -15 - C7 -4AL2 2.8 DEF_ECOLI
45 PsiBlast_CBE 75.5645% -11 - C7 -1BSZ 4.7 DEF_ECOLI
72 PsiBlast_CBE 75.2741% -30 - C7 -4DR9 6.7 ?
75 PsiBlast_CBE 75.1341% -32 - C7 -4DR8 3.3 ?
55 PsiBlast_CBE 75.0445% -11 - C7 -1BS4 5.0 DEF_ECOLI
20 PsiBlast_PDB 75.0045% -14 - C7 -1LRU 6.2 DEF_ECOLI
19 PsiBlast_PDB 74.9245% -19 - C7 -1G2A 6.1 DEF_ECOLI
42 PsiBlast_CBE 74.8345% -20 - C7 -1G2A 6.4 DEF_ECOLI
97 PsiBlast_CBE 74.5636% -62 - C7 -1RL4 4.1 ?
33 PsiBlast_CBE 74.5445% -14 - C7 -2AI8 3.8 DEF_ECOLI
8 PsiBlast_PDB 74.3245% -4 - C7 -2W3U 3.4 DEF_ECOLI
17 PsiBlast_PDB 74.2945% -16 - C7 -1BSK 6.4 DEF_ECOLI
76 PsiBlast_CBE 74.2041% -37 - C7 -4DR8 2.9 ?
43 PsiBlast_CBE 74.1245% -8 - C7 -1G27 4.9 DEF_ECOLI
41 PsiBlast_CBE 74.0545% -14 - C7 -1G2A 6.8 DEF_ECOLI
7 PsiBlast_PDB 74.0445% -16 - C7 -2W3T 2.4 DEF_ECOLI
32 PsiBlast_CBE 73.7345% -8 - C7 -2AI8 4.1 DEF_ECOLI
98 PsiBlast_CBE 73.5436% -63 - C7 -1RL4 4.0 ?
70 PsiBlast_CBE 73.2341% -35 - C7 -4DR9 6.3 ?
74 PsiBlast_CBE 73.0141% -32 - C7 -4DR8 3.3 ?
69 PsiBlast_CBE 72.5541% -34 - C7 -4DR9 6.6 ?
71 PsiBlast_CBE 72.3141% -35 - C7 -4DR9 6.7 ?
139 HHSearch 71.6233% -42 - C7 -1RL4 4.1 ?
92 PsiBlast_CBE 67.7035% -43 - C7 -3O3J 3.9 DEF1B_ARATH
86 PsiBlast_CBE 65.9740% -18 - C7 -2EW5 6.3 ?
108 PsiBlast_CBE 59.2132% 39 - C7 -1Y6H 3.4 DEF_LEPIN