@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y1T9: (2018-01-27 )
MNLDYYVVDAFADEVFKGNPAAVYVLEEWLPEGTMQKIAIENNLSETAFTVKKNQEFELRWFTPDREIDLCGHATLATAFVLFNYYKIPDETIKFSTQSGNLFVTRIKDYYYMDFPSIMPKKVPILTEYEEAIGAKIKEAYLARDLFFVLEDEKTVAKLQPDFTAIKNFELGIESS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BTB_A_3(4DUN)
?
[Raw transfer]




BTB_A_3(4DUN)
?
[Raw transfer]




29 HHSearch 99.0870%-163 - C2 -1S7J - ? -
1 PsiBlast_PDB 97.6970%-164 - C2 -1S7J - ? -
2 PsiBlast_PDB 88.4847%-141 - C2 -4DUN 2.9 ?
30 HHSearch 87.1545%-137 - C2 -4DUN 3.0 ?
36 HHSearch 71.0826% 12 - C2 -1YM5 - YHI9_YEAST -
35 HHSearch 70.2929% -48 - C2 -1SDJ - YDDE_ECOLI -
31 HHSearch 69.9430% -67 * C2 *1XUB - PHZF_PSEFL -
11 PsiBlast_PDB 69.3929% -46 - C2 -1U1V - PHZF_PSEFL -
9 PsiBlast_PDB 68.6630% -39 - C2 -1QY9 - YDDE_ECOLI -
34 HHSearch 68.1131% -69 - C2 -1T6K - PHZF_PSEFL -
13 PsiBlast_PDB 67.4028% -0 - C2 -1YM5 - YHI9_YEAST -
8 PsiBlast_PDB 67.0230% -43 - C2 -1SDJ - YDDE_ECOLI -
22 Fugue 66.9525% -4 - C2 -1YM5 - YHI9_YEAST -
10 PsiBlast_PDB 66.8229% -45 - C2 -1XUB - PHZF_PSEFL -
6 PsiBlast_PDB 66.4829% -44 - C2 -1T6K - PHZF_PSEFL -
7 PsiBlast_PDB 66.1729% -45 - C2 -5IWE - PHZF_PSEFL -
3 PsiBlast_PDB 65.9229% -45 - C2 -1U1W - PHZF_PSEFL -
4 PsiBlast_PDB 65.5729% -44 - C2 -1U1X - PHZF_PSEFL -
5 PsiBlast_PDB 65.1129% -48 - C2 -1XUA - PHZF_PSEFL -
21 Fugue 62.3427% -0 - C2 -1SDJ - YDDE_ECOLI -