@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y1U1: (2018-01-27 )
MKMAHTCVRVKDLEASIEFYQKAFGFEESRRRDFPENKFTLVYLTLPGDDYELELTYNYDHGAYDLGDGYGHIAIAADDLEKLHEQHKAAGLEITDLKGLPGTTPSYYFVIDPDGYKIEVIRG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_6(4MTT)
?
[Raw transfer]



MPD_C_15(2C21)
?
[Raw transfer]



MPD_E_22(2C21)
?
[Raw transfer]
9 PsiBlast_PDB 94.0140% 0 - C- -1FA8 - LGUL_ECOLI -
8 PsiBlast_PDB 94.0140% 0 - C- -1FA7 - LGUL_ECOLI -
7 PsiBlast_PDB 94.0140% 0 - C- -1FA6 - LGUL_ECOLI -
6 PsiBlast_PDB 94.0140% 0 - C- -1FA5 - LGUL_ECOLI -
5 PsiBlast_PDB 94.0140% 0 - C- -1F9Z - LGUL_ECOLI -
67 HHSearch 88.2339% 0 - C- -1F9Z - LGUL_ECOLI -
66 HHSearch 88.2339% 0 - C- -1FA7 - LGUL_ECOLI -
64 HHSearch 88.1842% -37 - C4 -4MTS - ? -
4 PsiBlast_PDB 85.9141% -20 - C4 -5D7Z - ? -
22 PsiBlast_CBE 85.6841% -38 - C4 -4MTS - ? -
65 HHSearch 85.2642% -39 - C4 -4MTS - ? -
24 PsiBlast_CBE 84.9441% -42 - C4 -4MTQ - ? -
21 PsiBlast_CBE 84.2341% -42 - C4 -4MTT - ? -
3 PsiBlast_PDB 83.7441% -39 - C4 -4MTT 3.3 ?
2 PsiBlast_PDB 83.0241% -39 - C4 -4MTS - ? -
75 HHSearch 83.0040% -45 * C4 *2C21 - ? -
29 PsiBlast_CBE 82.8739% -54 - C4 -2C21 - ? -
31 PsiBlast_CBE 82.1439% -58 - C4 -2C21 - ? -
32 PsiBlast_CBE 81.8739% -61 - C4 -2C21 3.9 ?
30 PsiBlast_CBE 81.4939% -59 - C4 -2C21 3.6 ?