@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y291: (2018-01-29 )
MKITEKDFGQGYHLITLENKNKLALSISDLGARIVSLKSNDRELVLGFDTAEEYIEKDPYIGASIGRTAGRIENGRFSLNGKTYQLATDPKTGHNLHGGAPGFELKKWSYVILNGENEASVIFTTTSPDGEHGFPGTMDVEIRYTLTKDNIWRVTSRGTSDQDTLFNPTNHVYFNLTGDASQSIDQHELWLNSEAYAPLRTDSIPIGVKENAAGSAFDFQIPKKLASVFASDLDQKNLVDGIDHPFFLKETGLGKEAARLTSPDKRIQVDIATDASSVVIFTANFGTETPEMRNRKLAHHGGITFETQTAPGAERFSAFGSIHLKAGSVFETVTEFKIKTRKE

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GLA_A_3(1NSU)
?
[Raw transfer]




GLA_A_3(1NS0)
?
[Raw transfer]




GLA_B_4(1NSU)
?
[Raw transfer]




GAL_A_3(1NS2)
?
[Raw transfer]




GLA_B_4(1NS8)
?
[Raw transfer]




GLA_B_4(1NSU)
?
[Raw transfer]




GAL_B_4(1NS2)
?
[Raw transfer]




GLA_A_3(1NS8)
?
[Raw transfer]




GLA_A_3(1L7K)
?
[Raw transfer]




GLA_B_4(1L7K)
?
[Raw transfer]




GLA_B_4(1NS0)
?
[Raw transfer]




BGC_A_3(1NS4)
?
[Raw transfer]




BGC_B_4(1NS4)
?
[Raw transfer]




GLC_B_4(1NSZ)
?
[Raw transfer]




GLC_A_3(1NSZ)
?
[Raw transfer]




BGC_B_4(1NS7)
?
[Raw transfer]




FUC_A_3(1MMX)
?
[Raw transfer]




GAL_B_4(1NSX)
?
[Raw transfer]




GAL_B_4(1NSX)
?
[Raw transfer]




GAL_A_3(1NSX)
?
[Raw transfer]




ARB_A_3(1MMZ)
?
[Raw transfer]




FUC_B_4(1MMX)
?
[Raw transfer]




ARB_B_4(1MMZ)
?
[Raw transfer]




BGC_A_3(1NS7)
?
[Raw transfer]




XYS_A_3(1MN0)
?
[Raw transfer]




BGC_B_5(1NSV)
?
[Raw transfer]




GAL_A_3(1NSM)
?
[Raw transfer]




BGC_A_3(1NSS)
?
[Raw transfer]




GLA_B_4(1NSM)
?
[Raw transfer]




GOL_B_14(3IMH)
?
[Raw transfer]




BGC_B_4(1NSS)
?
[Raw transfer]




XYS_B_4(1MN0)
?
[Raw transfer]




BGC_A_3(1MMU)
?
[Raw transfer]




BGC_B_5(1MMU)
?
[Raw transfer]




BGC_B_3(1NSR)
?
[Raw transfer]




G6D_A_3(1MMY)
?
[Raw transfer]




G6D_B_4(1MMY)
?
[Raw transfer]




BGC_A_3(1NSV)
?
[Raw transfer]




43 Fugue 93.9742% -10 - C- -1L7J - ? -
8 PsiBlast_PDB 91.3943% 15 - C2 -1NS0 3.3 ?
53 HHSearch 91.3442% -5 * C2 *1NSU 3.2 ?
16 PsiBlast_PDB 91.0543% 16 - C2 -1NSX 3.2 ?
52 HHSearch 90.5542% 11 - C2 -1NSX 3.5 ?
17 PsiBlast_PDB 90.4343% 16 - C2 -1NSZ 3.2 ?
19 PsiBlast_PDB 90.3743% 16 - C2 -1NSS 2.3 ?
18 PsiBlast_PDB 90.2243% 14 - C2 -1NSM 3.6 ?
9 PsiBlast_PDB 89.9943% 14 - C2 -1NS4 3.3 ?
12 PsiBlast_PDB 89.9243% 14 - C2 -1NS2 3.3 ?
5 PsiBlast_PDB 89.8543% 15 - C2 -1MMY 2.8 ?
33 PsiBlast_CBE 89.7043% 17 - C2 -1NSZ 3.6 ?
10 PsiBlast_PDB 89.6443% 15 - C2 -1NS8 3.5 ?
15 PsiBlast_PDB 89.4943% 17 - C2 -1NSV 2.3 ?
11 PsiBlast_PDB 89.4643% 16 - C2 -1NSR - ? -
2 PsiBlast_PDB 89.3643% 13 - C2 -1L7K 3.4 ?
6 PsiBlast_PDB 89.3543% 15 - C2 -1MMZ 2.8 ?
3 PsiBlast_PDB 89.3443% 13 - C2 -1MMU 2.7 ?
31 PsiBlast_CBE 89.2843% 15 - C2 -1NS7 3.5 ?
4 PsiBlast_PDB 89.2043% 16 - C2 -1MMX 3.2 ?
25 PsiBlast_CBE 88.8943% 16 - C2 -1MMU 3.5 ?
13 PsiBlast_PDB 88.8843% 16 - C2 -1NS7 3.4 ?
14 PsiBlast_PDB 88.7743% 15 - C2 -1NSU 3.1 ?
7 PsiBlast_PDB 88.3543% 15 - C2 -1MN0 2.7 ?
34 PsiBlast_CBE 88.2543% 19 - C2 -1NSX 3.4 ?
26 PsiBlast_CBE 88.1643% 17 - C2 -1L7K 3.7 ?
22 PsiBlast_CBE 88.0543% 18 - C2 -1MMZ 3.1 ?
29 PsiBlast_CBE 88.0143% 19 - C2 -1NSR 3.0 ?
28 PsiBlast_CBE 87.9843% 17 - C2 -1NS0 3.2 ?
38 PsiBlast_CBE 87.9643% 19 - C2 -1NSM 2.8 ?
37 PsiBlast_CBE 87.9543% 16 - C2 -1NSS 2.6 ?
27 PsiBlast_CBE 87.8743% 18 - C2 -1NS4 3.4 ?
23 PsiBlast_CBE 87.5843% 21 - C2 -1MMY 2.8 ?
30 PsiBlast_CBE 87.4043% 17 - C2 -1NS8 3.7 ?
24 PsiBlast_CBE 86.8543% 19 - C2 -1MMX 3.8 ?
32 PsiBlast_CBE 86.7843% 17 - C2 -1NS2 3.5 ?
35 PsiBlast_CBE 86.7243% 19 - C2 -1NSV 2.8 ?
21 PsiBlast_CBE 86.4443% 19 - C2 -1MN0 3.1 ?
36 PsiBlast_CBE 85.1743% 19 - C2 -1NSU 3.2 ?