@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y2D9: (2018-01-30 )
MKIGIIGAMEEEVKILRENLSEPLSWERAGALFISGSLGNHEVIVVRSGIGKVLASITTSLLIQQYGVNMVINTGSAGGIGEGLQVGDIVISDKVAYFDADATGFGYNPGQLPGMPLYYEASTYLRSEMVKAAKATNLNAKEGLIVTGDTFVDSPDKIKEILTNFPEALACEMEGAAVGQTARQFNIPFLIVRAMSDTADHSATQSFDEFIEDAGKRSAEMVIEFVKHLV

Atome Classification :

(81 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MTA_B_4(4BMZ)
MQMTN_HELPY
[Raw transfer]




TDI_A_5(1Y6Q)
MTNN_ECOLI
[Raw transfer]




TDI_B_6(1Y6Q)
MTNN_ECOLI
[Raw transfer]




MTA_C_3(1Z5O)
MTNN_ECOLI
[Raw transfer]




MTA_D_4(1Z5O)
MTNN_ECOLI
[Raw transfer]




MTH_D_4(1NC1)
MTNN_ECOLI
[Raw transfer]




TDI_B_8(4F2W)
?
[Raw transfer]




TDI_A_3(4F2W)
?
[Raw transfer]




2EL_B_7(4F2P)
?
[Raw transfer]




TDI_B_5(4X24)
MTNN_VIBC3
[Raw transfer]




MTM_A_3(3EEI)
?
[Raw transfer]




MTH_C_3(1NC1)
MTNN_ECOLI
[Raw transfer]




MTA_B_3(4G41)
?
[Raw transfer]




MTA_A_3(4BMZ)
MQMTN_HELPY
[Raw transfer]




MTM_D_4(1Y6R)
MTNN_ECOLI
[Raw transfer]




TDI_B_4(4WKB)
MTNN_VIBC3
[Raw transfer]




MTA_A_2(4P54)
MQMTN_HELPJ
[Raw transfer]




SAH_A_2(4OY3)
MQMTN_HELPJ
[Raw transfer]




MTM_B_4(3EEI)
?
[Raw transfer]




MTA_B_3(4G41)
?
[Raw transfer]




TDI_A_3(4WKB)
MTNN_VIBC3
[Raw transfer]




FMC_D_4(1NC3)
MTNN_ECOLI
[Raw transfer]




MTM_C_3(1Y6R)
MTNN_ECOLI
[Raw transfer]




FMC_C_3(1NC3)
MTNN_ECOLI
[Raw transfer]




BIG_C_5(3DP9)
MTNN_VIBCH
[Raw transfer]




FMC_A_2(3BL6)
MTNN_STAAM
[Raw transfer]




2EL_A_3(4F2P)
?
[Raw transfer]




SAH_A_2(4OY3)
MQMTN_HELPJ
[Raw transfer]




BIG_A_2(4WKC)
MTNN_ECOLI
[Raw transfer]




BIG_A_3(4F3C)
?
[Raw transfer]




BIG_B_5(4F3C)
?
[Raw transfer]




4CT_B_6(3O4V)
MTNN_ECOLI
[Raw transfer]




FMC_A_2(3BL6)
MTNN_STAAM
[Raw transfer]




FMC_B_4(3NM5)
MQMTN_HELPJ
[Raw transfer]




TDI_A_3(4X24)
MTNN_VIBC3
[Raw transfer]




MTM_B_4(3EEI)
?
[Raw transfer]




FMC_A_3(3NM5)
MQMTN_HELPJ
[Raw transfer]




4CT_A_3(3O4V)
MTNN_ECOLI
[Raw transfer]




BIG_A_3(3DP9)
MTNN_VIBCH
[Raw transfer]




4CT_A_3(3O4V)
MTNN_ECOLI
[Raw transfer]




DF9_A_3(3DF9)
MTNN_ECO57
[Raw transfer]




TDI_A_2(4WKN)
MQMTN_HELPJ
[Raw transfer]




DF9_B_4(3DF9)
MTNN_ECO57
[Raw transfer]




3QA_A_5(4WKP)
MQMTN_HELPJ
[Raw transfer]




3QA_D_10(4WKP)
MQMTN_HELPJ
[Raw transfer]




HCE_A_2(4WKO)
MQMTN_HELPJ
[Raw transfer]




4CT_A_2(5KB3)
MQMTN_HELPJ
[Raw transfer]




3QA_B_7(4WKP)
MQMTN_HELPJ
[Raw transfer]




4EH_A_2(4YNB)
MQMTN_HELPJ
[Raw transfer]




3QA_C_9(4WKP)
MQMTN_HELPJ
[Raw transfer]




4EZ_A_3(4YO8)
MQMTN_HELPJ
[Raw transfer]




BIG_A_2(4FFS)
MQMTN_HELPJ
[Raw transfer]




4F0_A_2(4YML)
MTNN_ECOLI
[Raw transfer]




4EZ_B_5(4YO8)
MQMTN_HELPJ
[Raw transfer]




SAH_A_4(4G89)
MTNN_KLEP7
[Raw transfer]




Q88_A_2(3MMS)
?
[Raw transfer]




ADE_B_4(4BMX)
MQMTN_HELPY
[Raw transfer]




ADE_B_7(4JOS)
?
[Raw transfer]




ADE_B_2(3NM6)
MQMTN_HELPJ
[Raw transfer]




ADE_A_6(4JWT)
?
[Raw transfer]




9DA_A_3(5UE1)
MTNN_VIBF1
[Raw transfer]




9DA_A_3(5UE1)
MTNN_VIBF1
[Raw transfer]




9DA_B_10(5UE1)
MTNN_VIBF1
[Raw transfer]




SR1_C_3(1Z5N)
MTNN_ECOLI
[Raw transfer]




2WP_A_2(4OJT)
MQMTN_HELPJ
[Raw transfer]




ADE_A_3(5CCE)
MQMTN_HELPJ
[Raw transfer]




SR1_E_5(1Z5N)
MTNN_ECOLI
[Raw transfer]




ADE_D_4(1JYS)
MTNN_ECOLI
[Raw transfer]




ADE_C_3(1JYS)
MTNN_ECOLI
[Raw transfer]




TRS_A_7(4QEZ)
MTNN_BACAN
[Raw transfer]




ADE_C_9(4QEZ)
MTNN_BACAN
[Raw transfer]




TRS_A_7(4QEZ)
MTNN_BACAN
[Raw transfer]




ADE_C_9(4QEZ)
MTNN_BACAN
[Raw transfer]




TRS_B_5(4QEZ)
MTNN_BACAN
[Raw transfer]




TRS_A_3(3NM4)
MQMTN_HELPJ
[Raw transfer]




EDO_B_6(3NM4)
MQMTN_HELPJ
[Raw transfer]




PGE_B_15(4F1W)
?
[Raw transfer]




PG4_A_5(4F1W)
?
[Raw transfer]




PG4_A_5(4F1W)
?
[Raw transfer]




EDO_A_6(4F2W)
?
[Raw transfer]




PE5_A_3(1Z5P)
MTNN_ECOLI
[Raw transfer]




GLY_A_2(5DK6)
MTNN_COLP3
[Raw transfer]




42 PsiBlast_CBE 95.2845%-117 - C1 -1Y6Q 6.2 MTNN_ECOLI
32 PsiBlast_CBE 95.1345%-116 - C1 -4F3C 6.5 ?
33 PsiBlast_CBE 94.8145%-116 - C1 -4F2W 6.3 ?
97 HHSearch 94.7746%-124 - C1 -4F1W 2.1 ?
44 PsiBlast_CBE 94.6245%-116 - C1 -1NC1 6.5 MTNN_ECOLI
50 PsiBlast_CBE 94.5045%-120 - C1 -1Z5O 6.6 MTNN_ECOLI
10 PsiBlast_PDB 94.2445%-124 - C1 -4F1W 2.1 ?
45 PsiBlast_CBE 94.2345%-129 - C1 -1JYS 3.7 MTNN_ECOLI
11 PsiBlast_PDB 94.0145%-114 - C1 -4F2P 6.2 ?
39 PsiBlast_CBE 93.9145%-132 - C1 -1Z5P 1.7 MTNN_ECOLI
96 HHSearch 93.4447%-110 - C1 -3BL6 6.1 MTNN_STAAM
2 PsiBlast_PDB 93.4447%-110 - C1 -3BL6 6.1 MTNN_STAAM
48 PsiBlast_CBE 93.4045%-118 - C1 -1Z5N 3.4 MTNN_ECOLI
40 PsiBlast_CBE 93.3945%-116 - C1 -1Y6R 6.1 MTNN_ECOLI
47 PsiBlast_CBE 93.3845%-116 - C1 -4WKC 6.9 MTNN_ECOLI
43 PsiBlast_CBE 93.3045%-113 - C1 -1NC3 6.0 MTNN_ECOLI
13 PsiBlast_PDB 93.2545%-116 - C1 -4F3C 6.7 ?
49 PsiBlast_CBE 93.2345%-122 - C1 -1Z5N 3.7 MTNN_ECOLI
36 PsiBlast_CBE 93.2345%-116 - C1 -3O4V 7.2 MTNN_ECOLI
51 PsiBlast_CBE 93.2045%-118 - C1 -1Z5O 6.5 MTNN_ECOLI
37 PsiBlast_CBE 92.7045%-118 - C1 -3DF9 6.8 MTNN_ECO57
35 PsiBlast_CBE 92.5145%-115 - C1 -4F1W 2.0 ?
101 HHSearch 92.4845%-124 - C1 -4G41 6.5 ?
52 PsiBlast_CBE 92.4845%-124 - C1 -4G41 6.5 ?
41 PsiBlast_CBE 92.4045%-116 - C1 -1Y6R 6.2 MTNN_ECOLI
38 PsiBlast_CBE 92.3345%-119 - C1 -3DF9 7.1 MTNN_ECO57
46 PsiBlast_CBE 92.2545%-119 - C1 -4YML 6.4 MTNN_ECOLI
12 PsiBlast_PDB 92.0545%-115 - C1 -4F2W 6.4 ?
34 PsiBlast_CBE 92.0445%-117 - C1 -4F2P 6.5 ?
20 PsiBlast_PDB 92.0345%-118 - C1 -1Y6Q 6.2 MTNN_ECOLI
9 PsiBlast_PDB 91.8844%-120 - C1 -4G89 3.4 MTNN_KLEP7
104 HHSearch 91.8246%-116 - C1 -3O4V 7.2 MTNN_ECOLI
110 HHSearch 91.6246% -85 - C1 -5UE1 3.9 MTNN_VIBF1
19 PsiBlast_PDB 91.5345%-117 - C1 -1NC1 6.1 MTNN_ECOLI
15 PsiBlast_PDB 91.2845%-116 - C1 -3O4V 7.2 MTNN_ECOLI
17 PsiBlast_PDB 91.2645%-132 - C1 -1JYS 3.5 MTNN_ECOLI
18 PsiBlast_PDB 91.2545%-117 - C1 -1NC3 6.0 MTNN_ECOLI
8 PsiBlast_PDB 89.8746% -79 - C1 -4WKB 6.3 MTNN_VIBC3
4 PsiBlast_PDB 88.9946%-119 - C1 -3MMS 4.2 ?
5 PsiBlast_PDB 88.9345% -84 - C1 -5UE1 3.9 MTNN_VIBF1
28 PsiBlast_CBE 88.7346% -79 - C1 -3DP9 6.3 MTNN_VIBCH
29 PsiBlast_CBE 88.4646% -77 - C1 -4WKB 6.1 MTNN_VIBC3
26 PsiBlast_CBE 88.0945% -81 - C1 -5UE1 3.9 MTNN_VIBF1
6 PsiBlast_PDB 87.6346% -77 - C1 -4X24 6.1 MTNN_VIBC3
27 PsiBlast_CBE 86.9446% -79 - C1 -4X24 6.0 MTNN_VIBC3
108 HHSearch 86.4843%-106 - C1 -4QEZ 3.6 MTNN_BACAN
7 PsiBlast_PDB 86.3746% -79 - C1 -3DP9 6.4 MTNN_VIBCH
107 HHSearch 83.7543%-106 * C1 *4QEZ 2.8 MTNN_BACAN
113 HHSearch 82.9443% -66 - C1 -3EEI 6.1 ?
54 PsiBlast_CBE 82.0043% -98 - C1 -4QEZ 3.6 MTNN_BACAN
98 HHSearch 81.3536%-110 - C1 -4JWT 3.9 ?
100 HHSearch 81.1037%-116 - C1 -4JOS 4.1 ?
109 HHSearch 80.6144% -54 - C1 -5DK6 2.8 MTNN_COLP3
55 PsiBlast_CBE 79.4543% -97 - C1 -4QEZ 2.9 MTNN_BACAN
56 PsiBlast_CBE 78.6343% -98 - C1 -4QEZ 2.8 MTNN_BACAN
58 PsiBlast_CBE 73.1244% -12 - C1 -3EEI 6.0 ?
57 PsiBlast_CBE 73.0344% -12 - C1 -3EEI 6.1 ?
106 HHSearch 72.7334% -20 - C1 -4OY3 7.2 MQMTN_HELPJ
67 PsiBlast_CBE 69.9735% -12 - C1 -4FFS 6.8 MQMTN_HELPJ
78 PsiBlast_CBE 69.7335% -13 - C1 -4WKN 6.1 MQMTN_HELPJ
70 PsiBlast_CBE 69.6335% -10 - C1 -4YO8 6.2 MQMTN_HELPJ
76 PsiBlast_CBE 69.5035% -10 - C1 -4WKP 6.6 MQMTN_HELPJ
68 PsiBlast_CBE 69.2735% -13 - C1 -5KB3 6.7 MQMTN_HELPJ
66 PsiBlast_CBE 69.2735% -12 - C1 -4OJT 3.6 MQMTN_HELPJ
80 PsiBlast_CBE 68.9835% -13 - C1 -4OY3 7.2 MQMTN_HELPJ
79 PsiBlast_CBE 68.8135% -13 - C1 -4P54 6.7 MQMTN_HELPJ
77 PsiBlast_CBE 68.6035% -13 - C1 -4WKO 6.2 MQMTN_HELPJ
75 PsiBlast_CBE 68.4435% -9 - C1 -4WKP 6.5 MQMTN_HELPJ
72 PsiBlast_CBE 68.1235% -10 - C1 -4YNB 6.7 MQMTN_HELPJ
73 PsiBlast_CBE 68.0635% -9 - C1 -4WKP 6.4 MQMTN_HELPJ
74 PsiBlast_CBE 67.8335% -10 - C1 -4WKP 6.3 MQMTN_HELPJ
71 PsiBlast_CBE 67.3935% -10 - C1 -4YO8 6.6 MQMTN_HELPJ
59 PsiBlast_CBE 66.9336% 13 - C1 -3NM6 3.9 MQMTN_HELPJ
69 PsiBlast_CBE 66.8235% -9 - C1 -5CCE 4.3 MQMTN_HELPJ
60 PsiBlast_CBE 66.4636% 19 - C1 -3NM5 5.7 MQMTN_HELPJ
85 PsiBlast_CBE 66.2434% -9 - C1 -4BMZ 6.5 MQMTN_HELPY
84 PsiBlast_CBE 66.0234% -11 - C1 -4BMZ 6.5 MQMTN_HELPY
82 PsiBlast_CBE 65.0234% -10 - C1 -4BMX 4.0 MQMTN_HELPY
61 PsiBlast_CBE 64.3236% 18 - C1 -3NM5 5.7 MQMTN_HELPJ
63 PsiBlast_CBE 64.0436% 14 - C1 -3NM4 2.4 MQMTN_HELPJ
62 PsiBlast_CBE 63.2836% 0 - C1 -3NM4 3.5 MQMTN_HELPJ