@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y2R7: (2018-02-01 )
MKGIILAGGSGTRLYPLTKATSKQLMPIYDKPMIYYPMSTLMLAGIKEILIISTPQDTPRFKELFGNGNDLGLQIEYAVQESPDGLAQAFIIGEEFIGDDSVCLVLGDNIYYGGGLSKMLQRAASKDTGATVFGYHVNDPERFGVVEFDENMQALSIEEKPAQPKSNYAVTGLYFYDNEVISIAKGIKPSERGELEITDVNKAYLDKGKLSVELMGRGFAWLDTGTHESLLEASTFIETIEKRQNLKVACLEEIAYRMGYIDKEQLLALAQPLKKNQYGQYLLNLAAE

Atome Classification :

(77 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DH5_A_5(5FU8)
?
[Raw transfer]




KDT_C_11(5FTV)
?
[Raw transfer]




BBE_D_11(4B5B)
?
[Raw transfer]




HNR_B_8(4ARW)
?
[Raw transfer]




DH5_C_11(5FU8)
?
[Raw transfer]




N5Y_C_11(4ASY)
?
[Raw transfer]




KDT_D_14(5FTV)
?
[Raw transfer]




LD6_C_12(5FYE)
?
[Raw transfer]




P3I_B_8(5FTS)
?
[Raw transfer]




HNR_C_12(4ARW)
?
[Raw transfer]




FKH_D_14(5FU0)
?
[Raw transfer]




FKH_C_11(5FU0)
?
[Raw transfer]




FKH_B_8(5FU0)
?
[Raw transfer]




BBE_C_9(4B5B)
?
[Raw transfer]




P3I_D_14(5FTS)
?
[Raw transfer]




FKH_A_5(5FU0)
?
[Raw transfer]




DH5_D_14(5FU8)
?
[Raw transfer]




KKT_C_10(4B4G)
?
[Raw transfer]




TTP_A_3(4HO3)
?
[Raw transfer]




BBE_B_7(4B5B)
?
[Raw transfer]




DAU_B_9(4HO5)
?
[Raw transfer]




TYD_A_13(1LVW)
?
[Raw transfer]




P3I_C_11(5FTS)
?
[Raw transfer]




UTP_B_11(4HO9)
?
[Raw transfer]




LD6_D_15(5FYE)
?
[Raw transfer]




HNR_D_16(4ARW)
?
[Raw transfer]




P3I_A_5(5FTS)
?
[Raw transfer]




DAU_A_4(4HO5)
?
[Raw transfer]




BBE_A_5(4B5B)
?
[Raw transfer]




KDT_A_5(5FTV)
?
[Raw transfer]




JWT_D_14(4B4M)
?
[Raw transfer]




JWT_C_11(4B4M)
?
[Raw transfer]




JWT_A_5(4B4M)
?
[Raw transfer]




LD6_B_9(5FYE)
?
[Raw transfer]




UTP_A_3(4HO6)
?
[Raw transfer]




HNR_A_5(4ARW)
?
[Raw transfer]




HKX_A_5(5FUH)
?
[Raw transfer]




TYD_D_19(1LVW)
?
[Raw transfer]




UTP_A_4(4HO9)
?
[Raw transfer]




HKX_D_16(5FUH)
?
[Raw transfer]




KKT_B_7(4B4G)
?
[Raw transfer]




HKX_A_5(5FUH)
?
[Raw transfer]




THM_B_9(4HO4)
?
[Raw transfer]




HKX_C_12(5FUH)
?
[Raw transfer]




THM_A_6(4HO8)
?
[Raw transfer]




HKX_B_9(5FUH)
?
[Raw transfer]




LD6_A_5(5FYE)
?
[Raw transfer]




THM_D_20(1H5R)
RMLA1_ECOLI
[Raw transfer]




KDT_B_8(5FTV)
?
[Raw transfer]




TTP_G_7(1IIM)
RMLA_SALTY
[Raw transfer]




THM_D_23(4HO8)
?
[Raw transfer]




THM_B_11(4HO8)
?
[Raw transfer]




KKT_D_13(4B4G)
?
[Raw transfer]




DH5_B_8(5FU8)
?
[Raw transfer]




TYD_D_12(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_A_3(4HO2)
?
[Raw transfer]




TYD_A_6(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_C_18(1H5R)
RMLA1_ECOLI
[Raw transfer]




TTP_G_7(1MP3)
RMLA_SALTY
[Raw transfer]




THM_A_5(4HO4)
?
[Raw transfer]




TTP_K_11(1MP3)
RMLA_SALTY
[Raw transfer]




KKT_A_5(4B4G)
?
[Raw transfer]




TMP_A_5(1H5S)
RMLA1_ECOLI
[Raw transfer]




TMP_D_11(1H5S)
RMLA1_ECOLI
[Raw transfer]




TMP_C_9(1H5S)
RMLA1_ECOLI
[Raw transfer]




TYD_B_8(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_C_17(4HO8)
?
[Raw transfer]




TYD_C_10(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_A_14(1H5R)
RMLA1_ECOLI
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




TMP_B_7(1H5S)
RMLA1_ECOLI
[Raw transfer]




JWT_B_8(4B4M)
?
[Raw transfer]




THM_B_16(1H5R)
RMLA1_ECOLI
[Raw transfer]




21 PsiBlast_CBE 96.1076%-137 - C1 -4HOC - ? -
8 PsiBlast_PDB 95.6476%-136 - C1 -4HO9 4.2 ?
9 PsiBlast_PDB 95.6376%-138 - C1 -4HOC - ? -
5 PsiBlast_PDB 95.4176%-135 - C1 -4HO5 5.5 ?
4 PsiBlast_PDB 95.3376%-139 - C1 -4HO4 4.0 ?
26 PsiBlast_CBE 95.2176%-144 - C1 -4HO5 5.1 ?
3 PsiBlast_PDB 95.1576%-143 - C1 -4HO3 5.1 ?
1 PsiBlast_PDB 95.0576%-141 - C1 -4HO0 - ? -
6 PsiBlast_PDB 94.7776%-139 - C1 -4HO6 4.5 ?
2 PsiBlast_PDB 94.6876%-142 - C1 -4HO2 4.1 ?
27 PsiBlast_CBE 94.5276%-144 - C1 -4HO4 4.0 ?
23 PsiBlast_CBE 94.1976%-137 - C1 -4HO8 4.0 ?
22 PsiBlast_CBE 94.1176%-140 - C1 -4HO9 5.1 ?
104 HHSearch 94.0970%-134 - C1 -5FUH 4.8 ?
24 PsiBlast_CBE 94.0176%-139 - C1 -4HO8 3.7 ?
48 PsiBlast_CBE 93.7969%-137 - C1 -3PKP - RMLA_SALTY -
7 PsiBlast_PDB 93.7176%-138 - C1 -4HO8 4.0 ?
82 PsiBlast_CBE 93.6970%-135 - C1 -5FTV 6.0 ?
25 PsiBlast_CBE 93.5976%-138 - C1 -4HO8 3.9 ?
76 PsiBlast_CBE 93.5270%-134 - C1 -5FU8 6.0 ?
73 PsiBlast_CBE 93.4770%-134 - C1 -5FU8 6.2 ?
78 PsiBlast_CBE 93.4570%-134 - C1 -5FU0 6.0 ?
88 PsiBlast_CBE 93.2470%-133 - C1 -5FTS 6.0 ?
92 PsiBlast_CBE 93.2370%-129 - C1 -4B5B 6.1 ?
74 PsiBlast_CBE 93.2070%-131 - C1 -5FU8 6.3 ?
80 PsiBlast_CBE 93.1970%-136 - C1 -5FU0 5.9 ?
97 PsiBlast_CBE 93.1870%-130 - C1 -4B4G 4.2 ?
72 PsiBlast_CBE 93.1870%-135 - C1 -5FUH 4.8 ?
71 PsiBlast_CBE 92.7670%-132 - C1 -5FUH 4.4 ?
75 PsiBlast_CBE 92.7470%-130 - C1 -5FU8 6.0 ?
62 PsiBlast_CBE 92.6970%-137 - C1 -4ARW 5.0 ?
91 PsiBlast_CBE 92.6870%-131 - C1 -4B5B 5.5 ?
85 PsiBlast_CBE 92.6170%-130 - C1 -5FTS 6.1 ?
65 PsiBlast_CBE 92.5670%-140 - C1 -5FYE 6.0 ?
106 HHSearch 92.5064%-149 - C1 -1LVW 5.4 ?
64 PsiBlast_CBE 92.4070%-132 - C1 -4ARW 4.8 ?
63 PsiBlast_CBE 92.3770%-128 - C1 -4ARW 4.9 ?
84 PsiBlast_CBE 92.3070%-135 - C1 -5FTV 5.8 ?
99 PsiBlast_CBE 92.2470%-139 - C1 -4B4G 5.2 ?
77 PsiBlast_CBE 92.2470%-128 - C1 -5FU0 5.8 ?
11 PsiBlast_PDB 92.2472%-137 - C1 -1H5R 3.1 RMLA1_ECOLI
66 PsiBlast_CBE 92.2270%-132 - C1 -5FYE 5.9 ?
100 PsiBlast_CBE 92.1370%-134 * C1 *4B4G 4.8 ?
96 PsiBlast_CBE 92.1370%-132 - C1 -4B4M 5.8 ?
93 PsiBlast_CBE 92.1370%-130 - C1 -4B4M 5.9 ?
70 PsiBlast_CBE 92.1370%-136 - C1 -5FUH 4.6 ?
67 PsiBlast_CBE 92.1370%-132 - C1 -5FYE 6.0 ?
89 PsiBlast_CBE 92.0870%-128 - C1 -4B5B 6.0 ?
61 PsiBlast_CBE 92.0270%-130 - C1 -4ARW 4.7 ?
12 PsiBlast_PDB 92.0272%-134 - C1 -1H5T 3.9 RMLA1_ECOLI
105 HHSearch 91.9970%-127 - C1 -4ASY 5.6 ?
10 PsiBlast_PDB 91.9871%-132 - C1 -1H5S 4.0 RMLA1_ECOLI
36 PsiBlast_CBE 91.9770%-132 - C1 -1H5T 3.9 RMLA1_ECOLI
40 PsiBlast_CBE 91.8870%-131 - C1 -1H5R 3.8 RMLA1_ECOLI
87 PsiBlast_CBE 91.8770%-134 - C1 -5FTS 6.1 ?
41 PsiBlast_CBE 91.8271%-136 - C1 -1H5S 4.0 RMLA1_ECOLI
39 PsiBlast_CBE 91.7770%-129 - C1 -1H5R 3.9 RMLA1_ECOLI
68 PsiBlast_CBE 91.7570%-131 - C1 -5FYE 6.0 ?
69 PsiBlast_CBE 91.7370%-131 - C1 -5FUH 4.4 ?
107 HHSearch 91.6864%-155 - C1 -1LVW 5.1 ?
34 PsiBlast_CBE 91.6670%-132 - C1 -1H5T 3.9 RMLA1_ECOLI
79 PsiBlast_CBE 91.6070%-128 - C1 -5FU0 5.8 ?
95 PsiBlast_CBE 91.5970%-130 - C1 -4B4M 5.3 ?
90 PsiBlast_CBE 91.4570%-131 - C1 -4B5B 6.1 ?
86 PsiBlast_CBE 91.4070%-130 - C1 -5FTS 5.5 ?
98 PsiBlast_CBE 91.2670%-132 - C1 -4B4G 5.1 ?
94 PsiBlast_CBE 91.2170%-133 - C1 -4B4M 6.2 ?
59 PsiBlast_CBE 91.2169%-132 - C1 -1MP3 4.0 RMLA_SALTY
38 PsiBlast_CBE 91.2070%-131 - C1 -1H5R 3.6 RMLA1_ECOLI
81 PsiBlast_CBE 91.1670%-128 - C1 -5FTV 5.9 ?
45 PsiBlast_CBE 91.0569%-131 - C1 -1IIM 4.2 RMLA_SALTY
83 PsiBlast_CBE 90.9870%-129 - C1 -5FTV 5.7 ?
35 PsiBlast_CBE 90.6270%-131 - C1 -1H5T 3.9 RMLA1_ECOLI
28 PsiBlast_CBE 90.0872%-135 - C1 -1H5S 4.1 RMLA1_ECOLI
37 PsiBlast_CBE 89.8470%-134 - C1 -1H5S 4.0 RMLA1_ECOLI
14 PsiBlast_PDB 89.7969%-134 - C1 -1IIM 3.8 RMLA_SALTY
19 PsiBlast_PDB 89.3069%-131 - C1 -1MP3 3.9 RMLA_SALTY