Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RRMCILTLAEKTQNPEKPNFLEDTYQEVEAPAAAMLSYGGHEIHFELDKNC--WPRLRHGSAVPPGYSAHIYSEGSDKYPPTSAVIEGTHVQKLPGFNPKGNVRFYEKLIGLS 5AA7 Chain:A ((31-68)) -------------------------QSVEAPKGATTCSGGNEAFAILDDNSKPWPTTEIASTV--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5AA7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 -1267 -19.79 -35.18 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -19.79 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.359

(partial model without unconserved sides chains): PDB file : Tito_5AA7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AA7-query.scw PDB file : Tito_Scwrl_5AA7.pdb: