Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DPKNCKFNVLNGSGINVANGCCDVTKKQVTVSPFTVSCTESC--GLAIVSGGDPTFSLQNAGRC 5FJ8 Chain:B ((772-825)) --------VLNKSSIDRGFGRCETRRKTTTVLKRYANHTQDIIGGMRVDENGDPIWQHQSLG--

General information: TITO was launched using: RESULT: Template: 5FJ8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 43 1969 45.78 37.86 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain B : 0.70 3D Compatibility (PKB) : 45.78 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.324

(partial model without unconserved sides chains): PDB file : Tito_5FJ8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FJ8-query.scw PDB file : Tito_Scwrl_5FJ8.pdb: