Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKIVGKHSEYTYQLLTRYPNPQKRIEAGFDKLIEIKRLTASNSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFS 2X1G Chain:F ((874-936)) -----GEQTLYTAMMCVGYLTPRSQVDKFADILLAMNRKYAAEMAVWMKSLMSTPNFPTQLITDADKT----------

General information: TITO was launched using: RESULT: Template: 2X1G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 150 -5227 -34.84 -82.96 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain F : 0.65 3D Compatibility (PKB) : -34.84 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.382

(partial model without unconserved sides chains): PDB file : Tito_2X1G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2X1G-query.scw PDB file : Tito_Scwrl_2X1G.pdb: