Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTVGNDLVRNQLHADRKWYLILGFVLIIFGLVLFSSLPFATFSVVFLFGILMMVGGVLHLIAALSVFKGGSRWLWALFGVLYLMAGYYAFSTPVTTAVVLTSLLSIALIIAGVIRTINAFLLRPIAGWGWTLFSGLLTLATGILILVSKDSPFWVLGMFLAVDILFQGINFLGLASAIKHLPSSSKTVS 2IEM Chain:A ((20-87)) -----------------------------------TPMPVATLHAVNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVSS---------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2IEM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 158 -30424 -192.56 -447.41 target 2D structure prediction score : 0.12 Monomeric hydrophicity matching model chain A : 0.47 3D Compatibility (PKB) : -192.56 2D Compatibility (Sec. Struct. Predict.) : 0.12 1D Compatibility (Hydrophobicity) : 0.47 QMean score : -0.001

(partial model without unconserved sides chains): PDB file : Tito_2IEM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IEM-query.scw PDB file : Tito_Scwrl_2IEM.pdb: