Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPYVTLDISSASHPFYTGEVRQASNEGRVASFNKRFARFNRKS 2J28 Chain:Z ((1-64)) MKKDIHPKYEEIT-------ASCSCGNVMKIRSTVGHD------LNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRF-------

General information: TITO was launched using: RESULT: Template: 2J28.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Z - contact count / total energy / energy per contact / energy per residue : 201 14241 70.85 222.51 target 2D structure prediction score : 0.34 Monomeric hydrophicity matching model chain Z : 0.76 3D Compatibility (PKB) : 70.85 2D Compatibility (Sec. Struct. Predict.) : 0.34 1D Compatibility (Hydrophobicity) : 0.76 QMean score : -0.068

(partial model without unconserved sides chains): PDB file : Tito_2J28.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2J28-query.scw PDB file : Tito_Scwrl_2J28.pdb: