Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGK---NEPFDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREH 2C1D Chain:A ((66-146)) -------------LDKWNAAMGVN---GESCASCHQGPESMAGLRAVMPRVDEHTGKLMIMEDYVNACVTERM--GLEKWGVTSDNMKDMLSLISLQSRGM------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2C1D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 256 -4073 -15.91 -52.21 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -15.91 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.284

(partial model without unconserved sides chains): PDB file : Tito_2C1D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2C1D-query.scw PDB file : Tito_Scwrl_2C1D.pdb: