Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVSNFLLLSKEMNMAIYVDNMRIKHKGKEWCHLMADSLEELHDFALTLGVKRCWFHKNASYPHYDVTVEVRNRALIYGAVPAERKKIIECGRKLRIELLNNNQINRYNKLQIELF 1D1J Chain:A ((62-111)) --------------------------------------------GLTLGAKKCSVIRDSLYVDGDCTMDIRTKS--QGGEPTYNVAVGRAGRALVI-------------------

General information: TITO was launched using: RESULT: Template: 1D1J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 146 -15039 -103.00 -300.77 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -103.00 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.382

(partial model without unconserved sides chains): PDB file : Tito_1D1J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D1J-query.scw PDB file : Tito_Scwrl_1D1J.pdb: