Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKKGMINRELKREKTVAKYAVKRAELKATIANVNASDEERFEAMLKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW
5ME0 Chain:N ((2-101))-AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW


General information:
TITO was launched using:
RESULT:

Template: 5ME0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 264 3163 11.98 31.63
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain N : 0.88

3D Compatibility (PKB) : 11.98
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.88
QMean score : 0.504

(partial model without unconserved sides chains):
PDB file : Tito_5ME0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5ME0-query.scw
PDB file : Tito_Scwrl_5ME0.pdb: