Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTFAPFFQVLGISITLCTQAVFADEGISTQEADSLIKDDIASTQVLQEICPTFVGANKKLETNTQKIIAMYLSGYSNKSITFSALQNDSEYKTLLSEARQAAKEMDHHEQHELCEEVVNYKD 3ZTH Chain:A ((24-76)) ------------------------------------------------------VGQNNELKYYTWQILSWYFGGKKYSSEDLSIF--DYEEPTILDEAREIVKRSSYH--------------

General information: TITO was launched using: RESULT: Template: 3ZTH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 90 -2982 -33.13 -56.25 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -33.13 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.080

(partial model without unconserved sides chains): PDB file : Tito_3ZTH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZTH-query.scw PDB file : Tito_Scwrl_3ZTH.pdb: