Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ESCLVYYFQPDGSSVQKVQDVGDKITRYLAHAYNGSQKYEATINEGCKLSGKFPDEIKVVVMPIRV 5AZF Chain:A ((3-36)) ---------------------------HMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIV-----

General information: TITO was launched using: RESULT: Template: 5AZF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 35 2701 77.17 79.44 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 77.17 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.536

(partial model without unconserved sides chains): PDB file : Tito_5AZF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AZF-query.scw PDB file : Tito_Scwrl_5AZF.pdb: