Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCNISILKDGKYFTQKQEIAGWTVKFHD----LDGNYVGKCKNAHTYACTYVTCEDLAPGYSPGKSKDVVASGNVGSLGHD 2LW6 Chain:A ((22-98)) QCNHHLLYNGRHWGTIRKKAGWAVRFYEEKPGQPKRLVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGS----

General information: TITO was launched using: RESULT: Template: 2LW6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 314 5200 16.56 71.23 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : 16.56 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.203

(partial model without unconserved sides chains): PDB file : Tito_2LW6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LW6-query.scw PDB file : Tito_Scwrl_2LW6.pdb: