Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 3OVE Chain:A ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3OVE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 -40604 -148.73 -534.26 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -148.73 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.842

(partial model without unconserved sides chains): PDB file : Tito_3OVE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OVE-query.scw PDB file : Tito_Scwrl_3OVE.pdb: