Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNH
2EO6 Chain:A ((25-108))WYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVAFFNKRVYNIPVRFIEATKQYALGKKKNGEEYFGSVVEIVNSH


General information:
TITO was launched using:
RESULT:

Template: 2EO6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 308 -42668 -138.53 -507.95
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.98

3D Compatibility (PKB) : -138.53
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.98
QMean score : 0.510

(partial model without unconserved sides chains):
PDB file : Tito_2EO6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2EO6-query.scw
PDB file : Tito_Scwrl_2EO6.pdb: