Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHY 2CI8 Chain:A ((3-77)) WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHY

General information: TITO was launched using: RESULT: Template: 2CI8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 240 -3609 -15.04 -48.12 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -15.04 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.444

(partial model without unconserved sides chains): PDB file : Tito_2CI8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CI8-query.scw PDB file : Tito_Scwrl_2CI8.pdb: