Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY 3EAC Chain:A ((82-156)) WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY

General information: TITO was launched using: RESULT: Template: 3EAC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 269 -55408 -205.98 -738.77 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -205.98 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.669

(partial model without unconserved sides chains): PDB file : Tito_3EAC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EAC-query.scw PDB file : Tito_Scwrl_3EAC.pdb: