Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKTFLKDKEKIVNALQLPYSNAKLEATNNLIKLIKHNAFGFRNFENFKKERTKFVLSRSSLSSTHYS 5GJQ Chain:S ((295-326)) ------------IKAIQLEYSEARRTMTNALRKAPQHTAVGFKQ------------------------

General information: TITO was launched using: RESULT: Template: 5GJQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 32 1898 59.30 59.30 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain S : 0.68 3D Compatibility (PKB) : 59.30 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.383

(partial model without unconserved sides chains): PDB file : Tito_5GJQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GJQ-query.scw PDB file : Tito_Scwrl_5GJQ.pdb: