Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKSSILFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLALFYMIPALYFLFRIGKKWELPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDSPFLNAFESAIVAPLVEEPLKLLPLVFVLALIPVRKLKFLFLLGIASGLGFQMIEDIGYIRTDLPEGFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIV 2DEC Chain:A ((14-74)) ------------------------------------------------IIKADKVFNKVKDKISLPNRILYLGCGSSHFLSKLLAMVTN--MHGGLGIALPCSEFLYSKET------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2DEC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 126 -18766 -148.94 -307.64 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.47 3D Compatibility (PKB) : -148.94 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.091

(partial model without unconserved sides chains): PDB file : Tito_2DEC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DEC-query.scw PDB file : Tito_Scwrl_2DEC.pdb: