Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MESHLVRIINRLEAMAN--DGGN--LKRNFEREGVVVAEVAYSHDEENGPIFTLRDVEDRETYTFDSIDLIAMEIYELLY 2FFG Chain:A ((2-78)) --SQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELL-

General information: TITO was launched using: RESULT: Template: 2FFG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 241 1413 5.86 19.36 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.82 3D Compatibility (PKB) : 5.86 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.649

(partial model without unconserved sides chains): PDB file : Tito_2FFG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FFG-query.scw PDB file : Tito_Scwrl_2FFG.pdb: