Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKGKEYENRTVSFAISSKGEKMKVENISYRVDHRILFDNISFDTSSSGVTLITGKNGTGKSTLL 4HZI Chain:A ((35-83)) ---------------------LSLEKISYKPTGKTILDSVSFEIKTNEHCVLLGRNGAGKSTLV

General information: TITO was launched using: RESULT: Template: 4HZI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 86 -11381 -132.34 -264.67 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -132.34 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.552

(partial model without unconserved sides chains): PDB file : Tito_4HZI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HZI-query.scw PDB file : Tito_Scwrl_4HZI.pdb: