Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ 3LVJ Chain:C ((13-78)) ------------LDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLI---

General information: TITO was launched using: RESULT: Template: 3LVJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 252 -45622 -181.04 -691.23 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain C : 0.70 3D Compatibility (PKB) : -181.04 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.331

(partial model without unconserved sides chains): PDB file : Tito_3LVJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3LVJ-query.scw PDB file : Tito_Scwrl_3LVJ.pdb: