Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNEIEMFCELLSLLGLKVVPKDYQSIDKERVAALLVMSKSWMNRIETVDDLFHDEISCQKEKLGY 2QK1 Chain:A ((325-362)) ---------------LDKLPKDFQ----ERIT-----SSKWKDRVEALEE-FWDSVLSQTKKL--

General information: TITO was launched using: RESULT: Template: 2QK1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 66 -922 -13.96 -24.25 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -13.96 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.508

(partial model without unconserved sides chains): PDB file : Tito_2QK1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QK1-query.scw PDB file : Tito_Scwrl_2QK1.pdb: