Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 5UBP Chain:A ((84-114)) --------------------ESIDDLNELYETLKKMRNTERSIMEEKGLVD---------------------

General information: TITO was launched using: RESULT: Template: 5UBP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 -774 -32.25 -24.97 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -32.25 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.651

(partial model without unconserved sides chains): PDB file : Tito_5UBP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5UBP-query.scw PDB file : Tito_Scwrl_5UBP.pdb: