Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKSELIDAIAEKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA 2O97 Chain:B ((1-89)) MNKSQLIDKIAAGAD-SKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKER------------------AKVPSFRAGKALKDAV-

General information: TITO was launched using: RESULT: Template: 2O97.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 166 -10543 -63.51 -150.61 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.88 3D Compatibility (PKB) : -63.51 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.622

(partial model without unconserved sides chains): PDB file : Tito_2O97.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2O97-query.scw PDB file : Tito_Scwrl_2O97.pdb: