Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGITPMYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTCCGRCAPEARAIISEELAEIAARISVAA 4E6K Chain:G ((1-57)) -----MYVCLCQGVTDNQIRDAIYEGCCSYREVREATGVGTQCGKCASLAKQVVRETLNDLQ-------

General information: TITO was launched using: RESULT: Template: 4E6K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 217 -38861 -179.08 -681.76 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain G : 0.79 3D Compatibility (PKB) : -179.08 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.863

(partial model without unconserved sides chains): PDB file : Tito_4E6K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E6K-query.scw PDB file : Tito_Scwrl_4E6K.pdb: