Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQVQDPTFWGGNIAFWIQTLVFFISALIAIYTLRRNEAQAKKRATVDLVLSETQDMYFRDIKEKFGKYK 2N2A Chain:B ((135-156)) ------------------------------------RQQKIRK-YTMRRLLQETELVEP-----------

General information: TITO was launched using: RESULT: Template: 2N2A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 999 199.80 45.41 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : 199.80 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.284

(partial model without unconserved sides chains): PDB file : Tito_2N2A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2N2A-query.scw PDB file : Tito_Scwrl_2N2A.pdb: