Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRNKYKEVLCVAKEDMIEVEGTVVETLPNAMFKVELENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLNRGRITYRFK 2N8N Chain:A ((1-72)) ----------MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK

General information: TITO was launched using: RESULT: Template: 2N8N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 307 -38664 -125.94 -536.99 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.93 3D Compatibility (PKB) : -125.94 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.93 QMean score : 0.450

(partial model without unconserved sides chains): PDB file : Tito_2N8N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2N8N-query.scw PDB file : Tito_Scwrl_2N8N.pdb: