Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRKKQVIPMYVVKVMHGYIDKTGCRTREKNLDNLLIFKDKKESEAFAKRIGGRVKPIQEVRPD 3R64 Chain:A ((80-154)) --RAAELLEEHREEIVEWLIKESGSTRSKANLEITLAGNITKESASFPGRVHGRISP-------

General information: TITO was launched using: RESULT: Template: 3R64.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 96 230 2.40 4.18 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : 2.40 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.339

(partial model without unconserved sides chains): PDB file : Tito_3R64.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R64-query.scw PDB file : Tito_Scwrl_3R64.pdb: