Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MCRILGLSRQSYYYQSKPKKDESELEEVVAEEFIRSRKAYGSRKIKKALSKRGIQISRRKISRIMKNRGLKSSYTVAYFKVHHSTCNEAKTTNVLNS 5C24 Chain:A ((499-524)) --------------QAQPDKSESELVNQIIEQLIKKEKVY---------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5C24.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 26 2836 109.08 109.08 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : 109.08 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.701

(partial model without unconserved sides chains): PDB file : Tito_5C24.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5C24-query.scw PDB file : Tito_Scwrl_5C24.pdb: