Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GKNGLKDCQVSLTATSEARRSFWDTQYADYNDDVEISAGRHKFVIHVE-QDCGGSKVSGTIPPHHLVILSPMSGGGRRTIINSAGEVRLAAT 3THW Chain:A ((631-700)) --------------------------------RIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVI-----

General information: TITO was launched using: RESULT: Template: 3THW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 117 -2866 -24.50 -53.07 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -24.50 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.148

(partial model without unconserved sides chains): PDB file : Tito_3THW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3THW-query.scw PDB file : Tito_Scwrl_3THW.pdb: