Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNQNDKRKMMKGLYIVPLAAATLLLGACATTVKPTYVSPTQYQSLSCQQLQSEYNRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSSTKNTELSRVLGQQEAIVQAAQFKNCPIIVRKKTN 4WJ9 Chain:A ((348-423)) --------------------------------------------------KEQYDKILDLIESG----KKEGAKLECG-GGPWGNKGYFVQPTVFSNVTDEMRIAKEE---IFG---PVQQIMKFKSLDDVIKRANN

General information: TITO was launched using: RESULT: Template: 4WJ9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 249 -12665 -50.86 -166.64 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -50.86 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.121

(partial model without unconserved sides chains): PDB file : Tito_4WJ9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WJ9-query.scw PDB file : Tito_Scwrl_4WJ9.pdb: