Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRGIKMNSSIDQDPNRTLTLILYVLYIVAIFTGGLLAIIALIINYVKRSDVQGSIFASHFTWQIRTFWWYLAWNIIAFLPFIFLFFTGENTDLFAGVAISSTVFCVGVIAAAWIWIVYRAIRGLIALNDNRPMYQP 2WZL Chain:A ((260-274)) ---------------------------------------------------------------------------------------------------------------------LRCILGFVALDSSKR----

General information: TITO was launched using: RESULT: Template: 2WZL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 269 89.67 17.93 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.38 3D Compatibility (PKB) : 89.67 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.38 QMean score : 0.551

(partial model without unconserved sides chains): PDB file : Tito_2WZL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WZL-query.scw PDB file : Tito_Scwrl_2WZL.pdb: