Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSSIVYAFVGGLLLGIATVGYLYINGRIAGISGLLAQFISPSRDIFKSSAFWFIAGLVITPFIYGYFYQPEIEIKANSFVLILAGLLVGFGTRLGSGCTSGHGICGMSRLSKRSIIASAIFMFAGMLTVYIIRHVLG 1ZTO Chain:A ((10-16)) ----------------------------------------------------------------------------------------------SSGCNSH------------------------------------

General information: TITO was launched using: RESULT: Template: 1ZTO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 54 54.00 7.71 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain A : 0.35 3D Compatibility (PKB) : 54.00 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.35 QMean score : 0.927

(partial model without unconserved sides chains): PDB file : Tito_1ZTO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ZTO-query.scw PDB file : Tito_Scwrl_1ZTO.pdb: