Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNQNHGVATRLPNNNIHPFPAFVGPVHPSAVLQNVLDYSVQERMFEVCLQRLLSPDF--AGQTVSVIPEYQEEDFEGGVKLYMHPAVMAFLLILFLTSVYLLVGV 4AKH Chain:A ((2061-2129)) ---------------------------------------------FDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLV--

General information: TITO was launched using: RESULT: Template: 4AKH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 119 -15350 -128.99 -269.29 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -128.99 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.443

(partial model without unconserved sides chains): PDB file : Tito_4AKH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4AKH-query.scw PDB file : Tito_Scwrl_4AKH.pdb: