Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYYFKQQILVSFINEKIILFSCYVSLINDV-SLNKKADELN-DQNLIIFVHQLLLKIFLLTINSWICKNIT 3V1V Chain:A ((329-359)) ------------------LAGNATTIVNDLYSYTKELNSPGRHLNLPVV----------------------

General information: TITO was launched using: RESULT: Template: 3V1V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 34 -3366 -98.99 -116.05 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -98.99 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.159

(partial model without unconserved sides chains): PDB file : Tito_3V1V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V1V-query.scw PDB file : Tito_Scwrl_3V1V.pdb: