Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSNIYDSANQIEREIRELPEFKALKEAYEKVQANEEAHKLFKDFQAMQIELQEKQMSGQEFSDEDAMKAQEMAVKIQSEEVINDLMQKEQGFSTIINDLNRIIMTPVRDLYSE 5JN5 Chain:A ((453-529)) ---------------------------YEEVEA-EGANKMMKDLEALMFD---RSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVF---------

General information: TITO was launched using: RESULT: Template: 5JN5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 182 -8659 -47.57 -118.61 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -47.57 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.309

(partial model without unconserved sides chains): PDB file : Tito_5JN5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JN5-query.scw PDB file : Tito_Scwrl_5JN5.pdb: